KEGG   Vibrio cholerae O395: VC0395_A0267Help
Entry
VC0395_A0267      CDS       T00520                                 

Gene name
aceA
Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
vco  Vibrio cholerae O395
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:vco01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:vco00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2:281459..282772
Genome map
AA seq 437 aa AA seqDB search
MTLTRRQQIEALEKDWATNPRWKNVKRTYTAEEVVSLRGSVVPANTIAQRGADKLWELVN
GSAKKGYVNCLGALTGGQAVQQAKAGIEAIYLSGWQVAADNNTAGTMYPDQSLYPVDSVP
SVVRRINNAFRRADQIQWSNGKSPQDEGGIDYFLPIVADAEAGFGGVLNAYELMKSMIEA
GAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLIAARLAADVAGTTTLVIARTDANAA
DLLTSDSDPYDADFVTGERTSEGFYRVRAGIDQAISRGLAYAPYADLVWCETAKPDLEEA
RKFAEAIHAQYPDQLLAYNCSPSFNWEKNLDAKTIAHFQQALSDMGYKYQFITLAGIHNM
WFNMFELAHAYAQGEGMRHYVEMVQRREFEAASKGYTFVAHQQEVGTGYFDKMTNTIQGG
NSSVTALTGSTEEDQFH
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgacactgactcgtcgccaacaaattgaagcactagaaaaagattgggcaaccaaccca
cgctggaaaaatgtgaaacgcacttacaccgctgaagaagtggtgagtttgcgcggctcg
gttgtaccagccaataccatcgcccaacgtggtgcagacaaactgtgggaactggtgaat
ggttcagcgaaaaaagggtatgtgaactgtttgggcgcactcactggcggccaagcggtg
caacaagccaaggcgggcattgaagcgatttatctctctggctggcaagtggcggcggat
aacaacaccgcaggcaccatgtacccagaccaatctctctatccagtggattctgtaccg
tcagtcgtacgccgcatcaataatgcgtttcgtcgcgctgaccaaatccagtggtcaaac
ggcaaatcaccacaagatgaaggcggaattgattacttcctgccaatcgtcgcggatgcg
gaagccggttttggtggcgtactcaacgcttatgagttgatgaaatctatgattgaagcg
ggcgctgctggcgttcactttgaagaccaattggcttcggtgaaaaaatgtggccacatg
ggcggcaaagtattggtaccgactcaagaagcggtgcaaaaactgattgcagcacgtttg
gctgccgatgttgcaggcacgactacgttagtgattgctcgcaccgatgctaacgccgcc
gatttgctcacttcagacagcgatccgtacgatgccgatttcgtgaccggtgagcgtact
tccgaaggtttctaccgtgtacgcgcgggcattgaccaagcgatttctcgcggcttggct
tacgcaccttacgcagatttggtgtggtgtgaaaccgcgaagccggatctggaagaagcg
cgtaaatttgctgaagcgattcatgcacaatacccagatcaactgttggcttacaactgc
tcaccgtcgttcaactgggaaaagaatctcgatgcgaaaaccatcgcccatttccagcaa
gcgctgtcggacatgggttacaagtaccagttcatcacgttagcgggtattcacaacatg
tggtttaacatgtttgagttagcgcacgcttacgcgcaaggcgaaggtatgcgtcactat
gtcgaaatggtacagcgtcgcgaatttgaagcagcatccaaaggttataccttcgtggcg
caccaacaagaagtggggacgggttacttcgataagatgaccaacaccattcaaggcggc
aacagttcggtgacggctctgaccggctcaaccgaagaagatcaatttcactaa

DBGET integrated database retrieval system