KEGG   Vibrio cholerae O395: VC0395_A0793Help
Entry
VC0395_A0793      CDS       T00520                                 

Gene name
trpC_F
Definition
(GenBank) indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
vco  Vibrio cholerae O395
Pathway
vco00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vco01100  Metabolic pathways
vco01110  Biosynthesis of secondary metabolites
vco01130  Biosynthesis of antibiotics
vco01230  Biosynthesis of amino acids
Module
vco_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vco00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VC0395_A0793 (trpC_F)
Enzymes [BR:vco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     VC0395_A0793 (trpC_F)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     VC0395_A0793 (trpC_F)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ABQ21264
UniProt: A0A0H3AJC0
Position
2:complement(802755..804164)
Genome map
AA seq 469 aa AA seqDB search
MSEQLSEHISVQTAQMAQVLVKIVNDKYQWIEERKAKQPLASFHPLLTRSERDFYQALSG
DNTVFILECKKASPSKGLIREEFDLDYIASVYGEYASAISVLTDEKYFQGRFEFLPQVRA
QVAQPVLCKDFMVDPYQVYLARHYQADAILLMLSVLNDDQYRELAAVAHDLGMGVLTEVS
NEQELKRAVDLQAKVIGINNRNLRDLTTDLNRTKQLAPLIPQGTIIISESGIYTHQQVRD
LAEFANGFLIGSSLMAQSNLELAVRKIVLGEHKVCGLTHPDDAVKAYQAGSVFGGLIFVE
KSKRFVDVEQARLTMSGAPLQYVGVFQNHPAAQVADIATKLGLFAVQLHGEEDSAYVSEL
RASLPESIEIWKAYGVSDALPELLPEHIDRHLLDAKVGEQSGGTGRSFDWRLLPKHSDLM
LAGGLSAENVAQAAQLGCRGLDFNSGVESAPGKKDANQLQQVFQQLRNY
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagcagttgtctgagcatatttccgtacaaaccgcgcaaatggcgcaagtgctg
gtcaaaatcgtcaacgataaataccaatggattgaagagcgcaaagccaagcaacctctt
gctagctttcatccattactgactcgctcagagcgcgatttctatcaagccttgagcggc
gataacaccgtattcattctcgaatgcaaaaaagcctcaccttcaaaaggattgatccgc
gaagagtttgatctcgattacatcgcctctgtgtatggcgagtacgccagtgccatttcg
gtactgactgacgagaaatatttccaaggtcgttttgagtttttgccgcaagtgcgcgct
caagtggctcagcctgtcttgtgcaaagattttatggtcgacccgtatcaggtttatctg
gcgcgtcattatcaagcggatgcgattttgctgatgctgtctgtgctcaatgatgatcaa
tatcgtgaactggctgctgtggcgcacgaccttggtatgggcgtactcaccgaagtcagc
aacgaacaagaattgaaacgtgcagttgatctgcaagcgaaagtcatcggcatcaataac
cgcaatctgcgtgatttgaccaccgacctaaatcgcaccaagcagttggcgccgctcatt
ccacaaggcaccatcattatttccgaatccggtatttatacccatcagcaggtgcgtgat
ttggctgaatttgccaatggtttcttgattggtagctcgctgatggcgcaaagcaatctt
gaactggcggtgcgaaaaattgtgctaggtgaacataaggtgtgcggtttgactcatcct
gatgatgcggtgaaagcctaccaagccggttccgtttttggtggattgatttttgttgag
aagtccaaacgctttgtcgatgtagaacaagctcgcctgaccatgagcggcgcgccgcta
cagtatgtcggcgtgtttcaaaatcacccagcagcacaagtcgccgatattgcaaccaaa
cttggcttatttgcggtgcaactgcacggtgaggaagactctgcgtatgtaagcgaactg
cgcgcttcccttccagaatccattgaaatttggaaagcgtatggcgtgagtgatgcttta
cctgagctactaccagagcacatcgataggcatctgctcgatgccaaagtcggcgaacag
agtggcggcacaggacgcagttttgattggcgcttgctgccaaaacatagcgacctgatg
ctcgccggcggcttgagcgccgagaatgtcgcccaagcggcgcaacttggctgccgcgga
ctcgatttcaactctggcgtggaaagcgctccgggtaaaaaagacgccaaccagttacaa
caggttttccaacagttacggaattattag

DBGET integrated database retrieval system