KEGG   Vibrio cholerae O395: VC0395_A1273Help
Entry
VC0395_A1273      CDS       T00520                                 

Definition
pseudouridine synthase Rlu family protein
Orthology
K06177  
tRNA pseudouridine32 synthase / 23S rRNA pseudouridine746 synthase [EC:5.4.99.28 5.4.99.29]
Organism
vco  Vibrio cholerae O395
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2:complement(1352046..1352753)
Genome map
AA seq 235 aa AA seqDB search
MFDILFTHPDFLLINKHPNVSVHKDDGDTMLLQEVATQTGDAQLYLVHRLDKMTSGILLL
ARNATSASELSQGFAKRKVEKFYLAIGSKKPKKKQGLICGDMERSRRSSWKLVNSQENPA
ITQFFSATAAPGERLFLCKPHTGKTHQIRVALKSIGSAIVGDPIYNTADKSDRGYLHAFA
LRFTYQGEVYQWQCDPRQFSHLGQKWHEEAVSQGIENWLSPWDLPWPALKVGVKE
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatattctgtttacccatcctgattttctgcttatcaataaacaccccaacgta
tcggtccataaagatgatggcgatactatgttgctgcaagaagtggcgacgcaaacaggg
gatgcccagctctatttggtgcatcggttggataagatgacgtcagggattttgttgttg
gcaagaaatgccacctcggccagtgaactttcgcaaggctttgctaagcgcaaggttgaa
aaattctatctggcgattggcagtaaaaagccgaagaaaaaacaaggtttgatttgcgga
gatatggagcgctcacgtcgctcatcatggaagctggtgaactcgcaagaaaatccggcg
atcacgcaatttttctctgcgaccgcggcaccgggggagcgcttgtttttgtgtaagccc
cataccggaaaaacccaccaaattcgcgtagcgttaaaatcgattggttctgcgattgta
ggggatcctatttacaatacggcggataagtccgatcgcggttatctgcacgcttttgcc
ttgcgttttacctatcaaggagaggtttaccaatggcagtgcgatccgcgtcagttttca
cacttaggtcagaaatggcacgaagaagcggtgagccaagggattgaaaattggctatca
ccttgggatttaccttggccagcgctgaaagtgggggtgaaagagtag

DBGET integrated database retrieval system