KEGG   Vibrio cholerae O395: VC0395_A1273Help
Entry
VC0395_A1273      CDS       T00520                                 

Definition
pseudouridine synthase Rlu family protein
Orthology
K06177  
tRNA pseudouridine32 synthase / 23S rRNA pseudouridine746 synthase [EC:5.4.99.28 5.4.99.29]
Organism
vco  Vibrio cholerae O395
Brite
Enzymes [BR:vco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.28  tRNA pseudouridine32 synthase
     VC0395_A1273
    5.4.99.29  23S rRNA pseudouridine746 synthase
     VC0395_A1273
Transfer RNA biogenesis [BR:vco03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    VC0395_A1273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1352046..1352753)
Genome map
AA seq 235 aa AA seqDB search
MFDILFTHPDFLLINKHPNVSVHKDDGDTMLLQEVATQTGDAQLYLVHRLDKMTSGILLL
ARNATSASELSQGFAKRKVEKFYLAIGSKKPKKKQGLICGDMERSRRSSWKLVNSQENPA
ITQFFSATAAPGERLFLCKPHTGKTHQIRVALKSIGSAIVGDPIYNTADKSDRGYLHAFA
LRFTYQGEVYQWQCDPRQFSHLGQKWHEEAVSQGIENWLSPWDLPWPALKVGVKE
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatattctgtttacccatcctgattttctgcttatcaataaacaccccaacgta
tcggtccataaagatgatggcgatactatgttgctgcaagaagtggcgacgcaaacaggg
gatgcccagctctatttggtgcatcggttggataagatgacgtcagggattttgttgttg
gcaagaaatgccacctcggccagtgaactttcgcaaggctttgctaagcgcaaggttgaa
aaattctatctggcgattggcagtaaaaagccgaagaaaaaacaaggtttgatttgcgga
gatatggagcgctcacgtcgctcatcatggaagctggtgaactcgcaagaaaatccggcg
atcacgcaatttttctctgcgaccgcggcaccgggggagcgcttgtttttgtgtaagccc
cataccggaaaaacccaccaaattcgcgtagcgttaaaatcgattggttctgcgattgta
ggggatcctatttacaatacggcggataagtccgatcgcggttatctgcacgcttttgcc
ttgcgttttacctatcaaggagaggtttaccaatggcagtgcgatccgcgtcagttttca
cacttaggtcagaaatggcacgaagaagcggtgagccaagggattgaaaattggctatca
ccttgggatttaccttggccagcgctgaaagtgggggtgaaagagtag

DBGET integrated database retrieval system