KEGG   Vibrio cholerae O395: VC0395_A1672Help
Entry
VC0395_A1672      CDS       T00520                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
vco  Vibrio cholerae O395
Pathway
vco00020  Citrate cycle (TCA cycle)
vco00310  Lysine degradation
vco01100  Metabolic pathways
vco01110  Biosynthesis of secondary metabolites
vco01120  Microbial metabolism in diverse environments
vco01130  Biosynthesis of antibiotics
vco01200  Carbon metabolism
Module
vco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vco_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vco00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VC0395_A1672 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    VC0395_A1672 (sucB)
Enzymes [BR:vco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     VC0395_A1672 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ABQ21540
UniProt: A0A0H3AM43
Position
2:complement(1798499..1799713)
Genome map
AA seq 404 aa AA seqDB search
MTIEILVPDLPESVADATVATWHKKPGDMVARDEVIVEIETDKVVLEVPAPDAGVLEAIL
EQEGATVLSKQLLARLKPGAVAGEPTQDTPDATEPSPDKRHKASLTEESNDALSPAVRRL
LAEHNLEANQVKGSGVGGRITREDIEAHLAANKAKPAAKAEAPIAALAPVVGRSEKRVPM
TRLRKRIAERLLEAKNNTAMLTTFNEVNMKPIMDMRKQYQDVFEKRHGIRLGFMSFYVKA
VTEALKRYPEVNASIDGDDLVYHNYFDVSIAVSTPRGLVTPVLKNCDTLSLAQIEKGIKE
LAEKGRDGKLTVDELTGGNFTITNGGVFGSLMSTPIINPPQAAILGMHKIQDRAMVVDGK
IEILPMMYLALSYDHRSIDGRESVGFLVTVKELLEDPARLLLDV
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgaaattctggttccagatttgcctgaatcagttgcggatgccacggttgcg
acgtggcataaaaagccgggtgacatggttgctcgcgatgaagtgatcgttgaaattgaa
actgacaaagtggtgctggaagttccagcacccgatgccggtgttctggaagctattttg
gaacaagaaggtgcgacagtgctttctaaacaactgctggcacgtttgaagccaggcgct
gtagcgggtgaaccaacccaagatactccagatgctactgagccatcaccagataaacgc
cataaagcatcactaactgaagaaagcaatgatgcgctaagccctgcggttcgtcgcctg
cttgctgaacataacttggaagcaaaccaagttaaaggttctggtgtgggtggtcgtatt
acccgcgaagacatcgaagctcacttagccgcgaacaaagccaaaccagctgcgaaagct
gaagcccctatcgcagcgctggctcctgtcgtcggccgcagtgaaaagcgcgtgccaatg
acacgtctgcgtaagcgtatcgctgagcgtctgttggaagcgaaaaataacacggctatg
ctgacgacgtttaatgaagtgaacatgaaacctatcatggacatgcgtaagcaataccaa
gatgtgttcgaaaaacgtcatggcattcgtctgggctttatgtcgttctacgtgaaagct
gtcactgaagcgctgaagcgttacccagaagtgaacgcgtctatcgatggtgatgatctg
gtttaccacaactactttgatgtgagcattgccgtatcaaccccacgtggtctggttact
ccagtactgaaaaactgcgataccttgagtttggcgcaaattgaaaaaggcatcaaagag
ctagcagaaaaaggtcgtgacggtaaattgaccgtagacgaactgactggcggtaacttt
accatcaccaacggtggtgtgtttggttcactgatgtcaacgcctatcattaacccgcca
caagcggcgattctgggtatgcataagatccaagaccgcgccatggtggtggatggcaag
attgaaatcctgccaatgatgtatctagcgctgtcttatgaccaccgttcaatcgatggt
cgtgagtcggttggtttcctagtgaccgttaaagagttgctagaagatccagcccgtctg
ctgctcgatgtttaa

DBGET integrated database retrieval system