KEGG   Vibrio cholerae O395: VC0395_A1676Help
Entry
VC0395_A1676      CDS       T00520                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
vco  Vibrio cholerae O395
Pathway
vco00020  Citrate cycle (TCA cycle)
vco00190  Oxidative phosphorylation
vco00650  Butanoate metabolism
vco01100  Metabolic pathways
vco01110  Biosynthesis of secondary metabolites
vco01120  Microbial metabolism in diverse environments
vco01130  Biosynthesis of antibiotics
vco01200  Carbon metabolism
Module
vco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vco_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
vco_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vco00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VC0395_A1676 (sdhD)
   00650 Butanoate metabolism
    VC0395_A1676 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    VC0395_A1676 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ABQ20605
UniProt: A0A0H3AJJ5
Position
2:complement(1805133..1805477)
Genome map
AA seq 114 aa AA seqDB search
MVKHVSSFGRNGVHDYLLIRASAIILVLYTIYIVSFCAFTDISYVAWTQFFGSTFTKVFT
MLALVSVLIHGWIGLWQVLTDYIKCSKLRAGLQLVVIAVLLGYFFSGLFVLWGA
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagcatgtctcttcctttggtcgtaatggtgttcacgattacttattgatccgc
gcttcagcgatcatcttagttttgtacactatttatatcgtgagtttttgcgcgttcacg
gacatctcttatgtcgcgtggactcaattctttggtagcacgttcaccaaagtcttcaca
atgttggcattagtttcagtattgattcatggctggattggcctatggcaagtactgacg
gattacattaagtgctccaaattgcgtgcaggactgcaacttgtggtcatcgccgttcta
cttggatacttcttctctggcctatttgtattgtggggtgcctaa

DBGET integrated database retrieval system