KEGG   Vibrio cholerae O395: VC0395_A1734Help
Entry
VC0395_A1734      CDS       T00520                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
vco  Vibrio cholerae O395
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:vco01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:vco00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Structure
PDB: 

Jmol
Position
2:1856356..1857489
Genome map
AA seq 377 aa AA seqDB search
MTDSPVLALAKELISRQSVTPADAGCQDLMIERLKALGFEIESMVFEDTTNFWARRGTQS
PLFVFAGHTDVVPAGPLSQWHTPPFEPTVIDGFLHGRGAADMKGSLACMIVAVERFIAEH
PDHQGSIGFLITSDEEGPFINGTVRVVETLMARNELIDMCIVGEPSSTLAVGDVVKNGRR
GSITGDLKVKGTQGHVAYPHLANNPVHKALPALAELAATQWDEGNAYFPPTSFQIPNLQA
GTGASNVIPGEFDVQFNFRFSTELTDEEIKRRVHSVLDAHGLDYGVKWTLSGQPFLTDTG
ELLAAVVAAVEEVNHQAPALLTTGGTSDGRFIAQMGAQVVELGPVNATIHKVNECVRIAD
LEKLTDMYQKTLNHLLG
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgacagatagccctgtactggctctggcaaaagagctgattagccgccaatccgttact
cctgccgacgcaggatgtcaggatctgatgattgagcgcttaaaagcgctgggtttcgaa
attgaaagcatggtgtttgaagacaccaccaacttctgggctcgccgcggcacgcaatct
cccctgtttgtttttgcaggtcataccgatgtggtgcctgccggccctttgtcgcagtgg
cacactcctccttttgagccgactgtgattgatggtttcctgcatgggcgtggcgcagca
gatatgaaaggctcgctggcttgtatgattgtggcggtagagcgttttattgccgaacat
cccgatcatcaaggctcaatcggttttttgatcacttctgatgaagaaggcccctttatc
aacggtaccgtccgtgtcgtagaaacgctaatggcacgtaacgaactgatcgatatgtgt
atcgtcggtgagccgtccagtaccctagccgtaggcgatgtggtgaaaaatggccgtcgt
ggctccatcacgggggatttgaaggtaaaaggcactcaaggccatgttgcttatccgcat
ctggctaataatcccgtgcataaagcgctccccgcattggccgaactcgccgccacccaa
tgggatgaaggtaacgcctatttcccccccaccagctttcaaattcctaacctgcaagcg
ggtactggcgcatcgaatgtcatccccggtgaatttgatgtgcagtttaacttccgcttt
agtacagagctcaccgatgaagagatcaaacgccgcgtacattcggtcttggatgctcac
gggctcgattacggtgtgaaatggactctcagcggccaacccttcctgaccgatacgggc
gaactactggcagcagtagtcgcggccgtagaggaagtaaaccatcaagctcctgcgtta
ttgacgacaggcggaacatctgatggtcgcttcattgcccaaatgggcgcacaagtggtt
gagctcggtcccgtgaatgccaccattcacaaggtaaacgagtgtgtacgtattgcggat
ttagagaaattgaccgatatgtatcaaaaaaccttaaatcatcttttaggctaa

DBGET integrated database retrieval system