KEGG   Vibrio cholerae O395: VC0395_A1917Help
Entry
VC0395_A1917      CDS       T00520                                 

Gene name
lacZ
Definition
beta-D-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
vco  Vibrio cholerae O395
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vco00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    VC0395_A1917 (lacZ)
  Lipid metabolism
   00600 Sphingolipid metabolism
    VC0395_A1917 (lacZ)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    VC0395_A1917 (lacZ)
Enzymes [BR:vco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     VC0395_A1917 (lacZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2:complement(2040732..2043866)
Genome map
AA seq 1044 aa AA seqDB search
MYAVEQRRYWLVASRIQEDLMRNFSDILLSQDWQNPHIVKWHCRTPHVPLHSYRTEQEAR
LDVGGNRQSLNGQWRFALFEKPEAVEPAVIDPDFDDSAWAHIPVPSNWQMQGFDKPIYTN
IQYPFADRPPYVPQDNPTGCYRHRFTLEKQALTESIRIVFDGVNSAFHLWCNGHWVGYSQ
DSRLPAEFELTPYLQEGENLLVAMVLRWSDGSYLEDQDMWWLSGIFRDVYLYRKPILAIE
DFFIRTELDALYQHAELRVETRLSQVTRHHQVQVALFDAQGECVARSQALHTGQRVVDEK
GAWHDKTEHSLAICSPTLWSDEAPYLYRCVICLLDEDGAPIEFESAAVGFRKVEITQGLL
KLNGQPLLIRGVNRHEHHPELGHVMDEASMRRDIELMKQHNFNAVRTAHYPNHPRWYELC
DEYGLYVVDEANLETHGQFPMSRLSNDPQWVNAYLQRMIGMVERDKNHPCVIIWSLGNES
GIGTNHHAMYQWTKQRDPSRPVQYEGGGANTAATDIVCPMYARVDQHQPHPAVPKYALKN
WISLPQENRPLILCEYAHAMGNSLGAFYKYWQAFREFPRLQGGFIWDWVDQGISKWDSEG
RHYWGYGGDFGDTINDRQFCINGLLFPDRTPHPALHEVKKVQQPYQFSLSYPKLTIHNER
LFAALPLELVVSVLCDGQEIKQERLPLDIAPRGTITLDLASLPMLPEHEYHLNAVLLCRE
DQPWSNAGHCIASEQWCLQPRRSMLPKITHAPLPQWQQDGDKVRIEAANQQWQFNRQTGL
LEQWWQNGQPVLSEPLRDNFYRAVLDNDIGTSEAQHLDPNSWIARWHAAGLDKLRVECDD
LRVTTLNESVEVVIDVAHYHQQALALRTRWRYQIFGDARVELNVEVMLCSDLPPLPRVGL
TLALPVAENPVSWFGRGPHENYPDRLQSAHVGRYTATVDELHTPYIFPSENGLRCDTRQL
QVGALVVEGHFHFSLSRYSQTMLDKAKHSNELVAGDKWYLNLDAQHMGVGGDDSWSQSVH
PEFLLTQPHYQYQLTLRVKASSPQ
NT seq 3135 nt NT seq  +upstreamnt  +downstreamnt
atgtacgccgtagagcaaaggcgttattggcttgttgcttcgcgtattcaagaggatctt
atgcgcaacttctccgatattcttcttagccaagattggcaaaacccgcacatcgttaaa
tggcactgccgtacaccccatgttcctttgcacagttatcgcactgagcaggaggctcgt
ttggatgttggggggaatcgccaatctctaaatggtcagtggcggtttgctctgtttgag
aagccagaagcggttgagcctgcggtgatagacccggatttcgatgatagcgcttgggcg
cacattcctgtaccgagtaactggcagatgcaaggctttgataagccgatttacaccaat
atccaatatccatttgcggatcggccgccttacgtgccgcaagataatccaaccggctgt
tatcgccaccgttttacactggaaaaacaagcgctaaccgagtccattcgcattgtattt
gatggggtcaattcggcatttcatctgtggtgcaatggtcattgggtcggttattcgcaa
gatagccgcttgcctgccgagtttgagttaaccccttatctacaagagggtgaaaacctg
ttggtggccatggtgctgcgctggtctgatggctcttatttggaagaccaagatatgtgg
tggctgagtggcatctttcgcgatgtgtatctctaccgcaagccgatactcgcgattgaa
gatttttttatccgcactgaattagatgcgctttatcaacacgctgaattgcgagtagaa
acacgcttaagccaagtgactcgccatcatcaagtgcaagtggctttattcgatgcacaa
ggtgaatgcgtggcgcgttcacaagccttacatacaggccagcgtgtagtggatgaaaaa
ggagcatggcacgataaaaccgaacacagtttagcgatttgctctccgacactgtggagt
gatgaagcgccttatctttaccgctgcgtgatctgtttgcttgatgaagatggcgcgccg
attgagtttgaaagtgcagcagtgggttttcgcaaagtagaaatcactcagggactactg
aagctcaatggtcagcccttgttgatccgcggggtgaaccgtcatgaacatcatcccgaa
ttggggcatgtgatggatgaagcaagcatgcgccgcgatattgaattgatgaaacagcat
aatttcaatgcggtgcgtaccgcccattaccccaatcatccgcgttggtacgaactgtgt
gatgagtacggtttgtatgtggtggatgaggccaatctcgaaacccacggccaatttccg
atgagccgactttccaatgatccacaatgggtgaatgcctatttgcagcgcatgattggc
atggtggagcgcgataaaaaccacccttgtgtgatcatttggtcgctcggcaatgaatcg
gggattggtaccaatcatcacgccatgtatcagtggacgaaacagcgcgacccatcgcgt
cctgtgcaatacgaagggggcggcgctaatacggcggcgaccgatattgtttgcccgatg
tatgcgcgggtcgatcagcatcagccacatcctgcggttccaaaatatgcgctgaaaaat
tggatcagtttgccgcaggaaaaccgccccctcatcttgtgtgaatatgctcatgcgatg
ggcaacagcttgggcgcgttttataaatactggcaggcgtttcgtgagtttcctcgtctg
caaggtggctttatttgggattgggtcgatcagggcatttccaaatgggatagcgagggg
cgccactattggggctatggcggtgattttggcgatacgattaacgatcgccaattctgc
ataaacggtttgctgttcccagatcgcacgccgcatccggcattacatgaagtcaaaaaa
gtccagcagccgtaccagttttcgttgagctatcccaagctcaccattcacaatgagcgc
ttgtttgcagcgctgccgctggagctggtagttagtgtgctatgcgatgggcaagagatt
aagcaagaacgtctgccgcttgatattgcgccgcgcggcacaatcacgctggatttagcg
tcgctgccaatgttgccagagcatgaataccacctcaatgcagtcttattgtgtcgtgag
gatcagccatggtctaacgcggggcactgcatcgctagtgagcagtggtgtttgcagcca
cgaagaagcatgttacctaaaatcacacacgctccgctgcctcaatggcagcaagatgga
gataaggtgcgcatcgaggcggccaatcagcaatggcagtttaaccgccaaactgggcta
ttggagcagtggtggcaaaatggtcagcccgtattgagtgaaccgctgcgcgataacttt
taccgcgcggtgctggataacgatattggtactagcgaagcgcagcatcttgacccgaac
agctggatcgcacgttggcatgcggcgggcttagataagctgcgtgtggaatgtgacgat
cttcgcgtcaccaccttgaacgagagtgtcgaagtggtgatcgatgtcgcccattaccat
cagcaagcgttagcgcttcgtacccgttggcgttaccaaatcttcggtgatgcgcgggta
gaactgaatgttgaggtgatgctgtgttctgatttaccgccgctgccaagagtggggtta
acgctcgcattaccagtggcagaaaacccagtgtcttggtttggtcgcgggccgcatgag
aattatccggatcgtttgcaatcggcgcatgtggggcgatacaccgccacggtggatgag
ctgcatacaccgtacattttcccgagcgaaaatggtttgcgttgtgatactcgccagcta
caagtgggcgctttggtggtggaagggcattttcacttctcgctcagtcgctactcacaa
acgatgttggataaagccaaacacagcaacgagttggtggcgggcgataagtggtatctc
aatctggatgcgcagcatatgggcgtgggcggcgatgattcgtggagccaaagtgtgcac
cctgaatttttgctcactcagccgcactatcagtatcagctcaccttacgtgtgaaagcg
tcatccccacaataa

DBGET integrated database retrieval system