KEGG   Vibrio cholerae O395: VC0395_A1941Help
Entry
VC0395_A1941      CDS       T00520                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
vco  Vibrio cholerae O395
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:vco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VC0395_A1941 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VC0395_A1941 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    VC0395_A1941 (thrC)
Enzymes [BR:vco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     VC0395_A1941 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(2070829..2072109)
Genome map
AA seq 426 aa AA seqDB search
MKLYNIKENDEQVSFGQAVRQGLGRNQGLFFPAQLPKFDDIDALLAEDFVSRSSKILSAL
IGDELPADKIRAMVDSAFQFAAPIAKVKEGVYALELFHGPTLAFKDFGGRFMAQSLAAVS
NGGKITILTATSGDTGAAVAHAFYGMPDINVVILYPKGKISPLQEKLFCTLGKNIHTVAI
NGDFDACQALVKQAFDDAELRQQIGLNSANSINISRLMAQICYYFEAAAQMSKAERENLV
ISVPSGNFGNLTAGLLAKALGLSVKRFIAATNANDTVPRYLETGRWEPKPTVATTSNAMD
VSQPNNWPRIEELCQRMGWGLETLGKGAVSDEESAQAVQELYDLGYLCEPHGSIAYRVLE
EQRQLQETGLFLCTAHPAKFKEVVDDILGTDIALPAPLAKHAAMELLSQELNADFAALRT
LLVNVK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtacaacataaaagaaaatgatgaacaagtctcttttggtcaagccgttcgc
caagggttaggccgcaatcaaggcctattttttccggcacaattgccgaagtttgacgat
attgatgcgctattagccgaagatttcgtctctcgtagcagcaagattttatcggcgttg
attggcgatgaactgcctgcggataaaattcgcgctatggtggattccgcctttcaattc
gccgcaccgattgccaaagtgaaagagggcgtttacgcgctcgaattgttccacgggcca
acgctcgcgtttaaagattttggtggtcgctttatggcccagtctctggcggcggtctcg
aacggcggaaaaatcacgattttgacggcgacatccggtgataccggcgctgctgttgcg
cacgcattttatggcatgccagatattaatgttgtgatcctttatccgaaaggaaaaatc
agtccgctgcaagaaaagctgttctgcacattaggtaaaaacattcacaccgtggcgatc
aatggtgattttgatgcttgccaagcgctagtgaaacaagcttttgatgacgcagagctg
cgtcaacagatcggtttgaactccgccaactcgatcaacatcagccgtttgatggcgcaa
atctgttactactttgaagccgctgcgcagatgagcaaagctgagcgtgaaaatctggtg
atttcagtgcctagtggcaactttggtaacttaaccgcagggctgttagccaaagcactg
ggtttatcggtgaagcgctttattgcggcaaccaatgccaacgatacagtgccacgttac
ttggaaacgggacgttgggaacccaaacccacggtagcaacaacgtcaaatgcgatggat
gtcagccaaccgaacaactggccgcgtatcgaagagctctgccaacgtatgggatggggc
ttagaaacgctgggcaaaggcgcggtttctgacgaggaaagtgcgcaagccgtacaagaa
ctttacgatctaggctacttgtgtgaaccgcatggttcgattgcttaccgtgtattggaa
gagcagcgccagctgcaagaaacggggctgttcttatgtaccgcgcatcccgccaaattc
aaagaagtggtggacgatattttaggtaccgacattgctctaccagcgccattggcaaaa
catgcggcgatggaattgctctcacaagagctgaatgccgatttcgcagcgctgcgtacg
ttactggtgaatgtgaaataa

DBGET integrated database retrieval system