KEGG   Vibrio cholerae O395: VC0395_A2280Help
Entry
VC0395_A2280      CDS       T00520                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
vco  Vibrio cholerae O395
Pathway
vco00230  Purine metabolism
vco01100  Metabolic pathways
Module
vco_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:vco00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    VC0395_A2280 (gmk)
Enzymes [BR:vco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     VC0395_A2280 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 RsgA_GTPase AAA_16 AAA_22 ABC_tran CPT AAA_18 MMR_HSR1 AAA_29 cobW
Motif
Other DBs
NCBI-ProteinID: ABQ20502
UniProt: A0A0H3AHK7
Position
2:2433747..2434436
Genome map
AA seq 229 aa AA seqDB search
MLSLNHCRLRQRHNPNLSGTESMGKGTLYIVSAPSGAGKSSLIAALLEQNPTYAMKVSVS
HTTRGMRPGEQDGVHYHFVEKEHFIELIGKGEFLEYAEVFGNYYGTSRVWIENTLNKGID
VFLDIDWQGARQIRSQMPEAKSIFILPPSKEELERRLNTRGQDSDAVIAKRMGEAKSEIS
HYSEYDYVIINDDFDVALMDFKAIIRAERLKQDKQAAKYSAMLSALLAE
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
gtgctatctttaaatcattgccggttaaggcaaagacacaatcccaacctaagtggaacc
gaatcgatgggcaaaggtactctttatatcgtttctgcacccagtggcgcaggcaaatca
agcttaattgccgccctattggagcaaaacccaacctatgcaatgaaagtctcggtctca
cataccacgcgtggtatgcgccccggcgaacaagatggcgttcattaccattttgtcgag
aaagaacatttcattgagcttatcggcaaaggggaattcctcgaatacgcagaagtgttt
ggcaactattacggcacttctcgggtgtggattgaaaacacactcaacaaagggattgat
gtgtttctcgatatcgactggcaaggtgcgcgtcaaatccgtagccaaatgccagaagcg
aaaagcatctttatcctgccgccttcgaaagaagagctggaacgccgcttaaacacgcgc
ggccaagacagcgatgcggtgatcgctaaacgcatgggtgaggctaaatctgagatttcg
cattacagcgaatatgattacgtcatcattaatgatgattttgatgtcgcgttaatggat
ttcaaagccatcattcgtgcagaaagattgaagcaagacaagcaagctgctaaatatagc
gctatgttgtctgctctgttggctgaataa

DBGET integrated database retrieval system