KEGG   Vibrio cholerae O395: VC0395_A2534Help
Entry
VC0395_A2534      CDS       T00520                                 

Gene name
fadB
Definition
multifunctional fatty acid oxidation complex subunit alpha (EC:5.3.3.8 5.1.2.3 1.1.1.35 4.2.1.17)
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
vco  Vibrio cholerae O395
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VC0395_A2534 (fadB)
   01212 Fatty acid metabolism
    VC0395_A2534 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    VC0395_A2534 (fadB)
   00650 Butanoate metabolism
    VC0395_A2534 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    VC0395_A2534 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    VC0395_A2534 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VC0395_A2534 (fadB)
   00310 Lysine degradation
    VC0395_A2534 (fadB)
   00380 Tryptophan metabolism
    VC0395_A2534 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VC0395_A2534 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    VC0395_A2534 (fadB)
   00281 Geraniol degradation
    VC0395_A2534 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    VC0395_A2534 (fadB)
Enzymes [BR:vco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     VC0395_A2534 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     VC0395_A2534 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     VC0395_A2534 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     VC0395_A2534 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2:complement(2685981..2688152)
Genome map
AA seq 723 aa AA seqDB search
MIYQAKTLQVKQLANGIAELSFCAPASVNKLDLHTLESLDKALDALAADSSVKGLLLSSD
KEAFIVGADITEFLGLFAKPEAELDEWLQFANRIFNKLEDLPFPTLSALKGHTLGGGCEC
VLATDFRIGDATTSIGLPETKLGIMPGFGGTVRLPRLIGADSAMEIITQGKACRAEEALK
VGLLDAIVDSDKLIDSAITTLTQAIEEKLDWQKRRQQKTSALTLSKLEAMMSFTMAKGMV
AQVAGKHYPAPMTSVVTIEEAARLPRDAALDIERKHFIKLAKSTEAQALVGIFLNDQYIK
GLAKQSAKAASQDTQHAAVLGAGIMGGGIAYQSALKGVPVLMKDIAPHSLELGMTEAAKL
LNKQLERGKIDGFKMAGILASITPSLHYAGIDQADVIVEAVVENPKVKAAVLSEVEGLVD
AETILTSNTSTIPINLLAKSLKRPQNFCGMHFFNPVHRMPLVEIIRGEHTSEDTINRVVA
YAAKMGKSPIVVNDCPGFFVNRVLFPYFAGFSLLMRDGANFTEIDKVMERQFGWPMGPAY
LLDVVGIDTAHHAQAVMAEGFPTRMAKSGREAIDALYEAKKFGQKNGSGFYQYTVDKKGK
PKKAFSDDVLAILAPVCGAPQNFDPQTLIERTMIPMINEVVLCLEEGIIASAQEADMALV
YGLGFPPFRGGVFRYLDTIGIANYVAMAEKYADLGALYQVPQLLKNMAQQGTSFYSAQQA
SAL
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgatttaccaagccaaaaccctacaggtaaagcaactcgctaatggaattgccgagctc
tctttctgtgctcctgcttccgttaacaaactggatttacacacactggaatccctcgat
aaagcgttagatgcgctcgctgccgattccagtgtcaaaggcctcctactcagctcagat
aaagaggcttttatcgtcggcgctgatatcaccgaatttctcgggctatttgccaaaccg
gaagcagaattggatgagtggttgcagtttgccaatcgcatttttaacaagttggaagat
ttacctttccccaccttgtcagcgttaaaaggccacacacttggcggcggctgtgaatgt
gtactcgccaccgattttcggattggtgatgccaccaccagcattggcttgcctgaaacc
aaactgggcatcatgccgggatttggcggcaccgtgcgtctgccacgtttgattggtgct
gatagcgcgatggaaatcatcacccaaggtaaagcgtgccgcgcggaagaagccttaaaa
gtgggattactggatgcgattgtcgatagcgacaaactgatcgattccgcaatcaccact
ttgactcaagcgattgaagaaaaactggattggcaaaaacgccgtcagcagaaaacctca
gcgctgactttaagcaagctggaagccatgatgagctttaccatggcaaaaggcatggtg
gcgcaagtggcaggcaaacactatccagcaccgatgacatctgtcgtgaccattgaagaa
gcggcgcgtttaccacgcgatgctgcgctggatatcgagcgcaaacacttcatcaagctc
gcaaaatctaccgaggcgcaagcactggttggtattttcctcaatgatcaatacatcaaa
ggcttagccaaacaatccgcgaaagcggcaagccaagacacccaacacgccgccgtgctc
ggcgcgggcattatgggtgggggcatcgcgtatcaatcggctctcaaaggcgtacctgtg
ctgatgaaagacatcgcaccgcactctttagagttgggcatgaccgaagcggccaagctc
ctcaacaaacagttagagcgcggcaagatcgatggattcaaaatggctggtattctggct
tccatcaccccttctctgcattacgcagggattgatcaggcggacgtgattgtcgaagcc
gtggtggaaaatccgaaagtcaaagccgcggtactgagcgaagtggaaggattggtcgat
gcagaaacgattctgacctccaacacctcgaccattcccattaacctgctcgccaaatca
ctcaagcgcccacagaacttctgcggtatgcacttctttaaccctgtgcatcgcatgcct
ttggtggaaatcatccgtggtgaacacacctcagaagacaccatcaaccgagtggtggct
tatgcggcgaaaatgggcaaatcaccgattgtggtcaatgactgcccaggattcttcgtt
aaccgcgtactcttcccttactttgcaggctttagcctactgatgcgtgatggtgctaac
ttcaccgaaatcgacaaagtgatggagcgtcaattcggctggccaatgggcccggcgtat
ttgcttgatgtggtcggcattgatactgcacaccatgctcaggcagtgatggccgaaggc
ttcccaactcgcatggccaaatctggccgagaagcgattgatgccctgtacgaagcgaaa
aaatttggccagaaaaatggcagcggcttctatcagtacaccgttgataaaaaaggcaaa
ccgaaaaaagccttcagcgatgacgtgctcgccattcttgcgcctgtatgcggcgcacca
caaaactttgacccacaaacccttatcgaacgcactatgattccgatgattaatgaagtg
gtgctctgtcttgaagaagggatcatcgcctccgcgcaagaagctgacatggcgttggtg
tacggtcttggcttccctccgttccgtggtggtgtatttcgttacctagataccataggc
atcgccaactatgtggctatggcggaaaaatacgctgacctcggcgcgctctatcaagta
ccgcaactgctgaagaacatggcgcaacaaggaacatctttctacagcgctcagcaagcc
agtgccctgtaa

DBGET integrated database retrieval system