KEGG   Vibrio cholerae O395: VC0395_A2602Help
Entry
VC0395_A2602      CDS       T00520                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
vco  Vibrio cholerae O395
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:vco03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2:2753768..2754577
Genome map
AA seq 269 aa AA seqDB search
MPELPEVEVSRLGISPHLVGGTIQSLVLRTPKLRWPIPQELKQLEGQTILAIHRRAKYLI
IETAVGSAIVHLGMSGSLRILDGDFPAAKHDHVDLVMTSGKRLRYNDPRRFGAWLWCAPD
ESHEVLGRLGPEPLTEAFNAEYMMDKARNKRIAVKAFIMDNAAVVGVGNIYANESLFTSR
LHPLRPAHSLSLEEWQTLVANIKQVLQVAIKQGGTTLKDFTQSDGKPGYFAQELQVYGKA
KQPCPHCGEPLCEQKIAQRNTFFCPQCQH
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattacctgaagttgaagtcagccgtttagggatctccccacatttggtcggt
ggcaccattcaatccttagtgttacgtacgcccaagttgcgctggcctatccctcaagag
ctgaaacagcttgaagggcagaccattctcgcgattcatcgtcgagccaagtatctgatt
attgaaaccgccgtcggcagtgcgattgtgcatttgggtatgtctggctcgctgcgtatt
ttggatggcgattttcctgccgcgaaacacgatcatgtggatctggtgatgaccagcggc
aaacggctgcgctataacgatccgcgtcgcttcggggcttggttatggtgtgcgcctgat
gagagccatgaagtgctcgggcgtttggggcctgagccgttgaccgaagcttttaacgct
gaatatatgatggacaaagcgcgcaacaaacgcattgcagtcaaagcttttatcatggac
aacgcagcggtcgtgggtgtggggaatatctatgctaatgaatcgctgtttacatcacgc
ctccatccactacgccccgctcattcgctgagcttagaggagtggcaaaccttagtggcg
aacatcaaacaagtgctgcaagtggcgattaagcaaggcggcaccacactgaaagatttt
acccaaagcgatggtaagccgggctatttcgcgcaagagctgcaagtgtatggcaaagcc
aaacagccttgcccccattgtggagagccgctttgcgagcagaaaattgctcagcgcaat
acctttttctgcccgcagtgccagcattga

DBGET integrated database retrieval system