KEGG   Vibrio cholerae O395: VC0395_A2813Help
Entry
VC0395_A2813      CDS       T00520                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
vco  Vibrio cholerae O395
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:vco00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    VC0395_A2813 (galU)
   00052 Galactose metabolism
    VC0395_A2813 (galU)
   00500 Starch and sucrose metabolism
    VC0395_A2813 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    VC0395_A2813 (galU)
Enzymes [BR:vco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     VC0395_A2813 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2:complement(2962719..2963642)
Genome map
AA seq 307 aa AA seqDB search
MVESAKNFSLAHHRAKMMIKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVDEA
IQAGITGMCIVTGRGKHSIMDHFDMNYELEHQIRGTNKEELLGDIRKIIESANFTFIRQR
EMKGLGHAILTGKELVGDEPFAVVLADDLCVNEEQGVLAQMVALYKQFRCSIVAVQEVPE
NETHKYGVIAGEMIKDDLFRVDNMVEKPEPGTAPSNLAIIGRYILTPDIFDLIEQTEPGK
GGEIQITDALLKQAKAGCVLAYKFKGKRFDCGSVEGYIEATNFCYENMYKKNDQKVELAK
KSTHKGQ
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtggtagagtcagcaaaaaatttctccctagcacaccatagagcaaaaatgatgattaag
aagtgtctatttccggcagctggctacggtacccgattcctaccagcgactaagtcgatg
cccaaagagatgatgcctgttgttaacaaaccgctgattgagtacggtgttgatgaagcg
attcaagcgggtatcacaggcatgtgtattgtgacaggtcgtggtaagcattcgatcatg
gatcactttgacatgaactacgagttagagcaccaaatccgcggtacgaataaagaagag
ctattgggtgatatccgtaaaatcatcgaaagcgctaactttacttttattcgccaacgc
gaaatgaaaggcttgggtcacgctatcttaacgggcaaagagctggtcggtgatgagccg
tttgccgttgtgctagcggacgacctgtgtgtgaacgaagagcaaggcgtactggcacag
atggttgcactgtacaaacagttccgctgctctatcgtcgctgtgcaagaggttccagaa
aacgaaactcacaaatacggcgtgatcgcaggtgagatgatcaaagacgatctgttccgc
gtcgataacatggtcgaaaaaccagagccgggcacagcgccaagcaacctcgccatcatt
ggccgttatatcctcacgccagatatttttgatctgattgagcagaccgagccgggcaaa
ggcggtgaaattcaaatcactgacgcgctgctcaaacaagccaaagcgggttgtgtactg
gcttataaattcaaaggtaagcgcttcgactgtggtagcgttgaaggctatatcgaagcc
accaacttctgctacgaaaacatgtacaagaaaaacgaccaaaaagtggagttggctaaa
aagtcgacgcacaaaggtcagtaa

DBGET integrated database retrieval system