KEGG   Vibrio cholerae O395: VC0395_A2858Help
Entry
VC0395_A2858      CDS       T00520                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
vco  Vibrio cholerae O395
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VC0395_A2858 (folA)
   00670 One carbon pool by folate
    VC0395_A2858 (folA)
Enzymes [BR:vco01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     VC0395_A2858 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:3011875..3012372
Genome map
AA seq 165 aa AA seqDB search
MMISMIAAMADQRIIGKDNQMPWHLPADFAWFKRCTLGKPVVMGRKTYQSIGRPLPGRHN
IVISRDASLQIEGVDVVTSIEAALAKAGEVDEVMIIGGGSLYAACLPMAHKLYITEIHAK
LDGDTQFPEWGSDWLERSREHYPADEKNAYGMDFVIFERQYPLPT
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgatgatcagtatgattgccgcgatggcagaccagcgcattattggtaaagataaccag
atgccttggcatctaccggctgatttcgcgtggttcaaacgctgtacattaggtaagcct
gtagtgatggggcgtaaaacctaccaatcgatcggacgtcctttaccggggcggcacaat
attgtgatctcccgtgatgcgagtttgcagattgagggggtggatgtggtgacctccatt
gaggcggcgctggcgaaagcgggtgaggtcgacgaggtgatgatcatcggaggtggtagc
ttgtatgcggcctgtttgccgatggcccataaactgtatattaccgagatccatgcaaaa
ttggatggtgatactcagtttcctgaatgggggagtgattggctagagcgctctcgtgag
cattatcctgccgatgaaaaaaatgcctacgggatggattttgtgatttttgaacgccaa
tatccccttcctacttga

DBGET integrated database retrieval system