KEGG   Vibrio cholerae O395: VC395_0061Help
Entry
VC395_0061        CDS       T02099                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
vcr  Vibrio cholerae O395
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vcr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    VC395_0061 (hemD)
Enzymes [BR:vcr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     VC395_0061 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:61911..62693
Genome map
AA seq 260 aa AA seqDB search
MIESVMTVLVTRPDEQGAELCQLLHQQGIPALHHPLLAISASPQLAALAEDLSSFDIIIA
VSQHAVIFSDQFLQHRRICWPNNAIYLAVGQKTAHVFSKACQQSVDYPEISDSEHLLALS
MLRDVAGKKVLILRGNGGRELIYSTLVERGATVRYQEAYCRHERPFAAAECVQKWQLAKV
DSLVITSSEQLAFFIRQFETSHLPWVQQLTLLVPSQRIATLAHQLGFHRIVVTLSAANRD
LVAALMPEKPTGTLSNDQQQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
ttgattgagagtgttatgacagtactggtcactcgtcctgatgaacaaggcgcagagctg
tgccagctgctgcaccagcagggcatccccgccctgcaccatccgctactcgccatctct
gccagccctcaacttgctgcgctggcagaagatttatcttcattcgatatcatcattgcc
gtcagtcaacatgccgtcatcttcagtgaccaatttctgcaacatcgccgaatttgttgg
ccaaataacgctatttaccttgccgttggtcaaaaaaccgcgcatgttttcagcaaagcc
tgccaacaatcagtagactatccagaaataagcgatagtgaacatctgctggcactcagt
atgctgcgtgatgtcgcaggtaagaaggtattgatcttacgtggtaatggtggtcgtgag
ctgatttattccaccttagtggaaagaggagcgactgtgcgctatcaagaagcgtattgt
cggcacgagcggccatttgccgccgccgagtgtgtccaaaaatggcagttggcgaaggtc
gactcactggtgatcaccagcagtgagcagttggctttttttatccgtcagttcgagaca
tcacacttgccatgggtgcagcagttaactttgctcgtacccagccaacggattgccact
ctcgcccaccaactaggatttcatcgcatcgtggtcacgctaagtgctgctaatcgcgat
ttagtcgcggcattgatgcccgaaaaaccaacaggaactctgagcaatgaccaacaacaa
taa

DBGET integrated database retrieval system