KEGG   Vibrio cholerae O395: VC395_0439Help
Entry
VC395_0439        CDS       T02099                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
vcr  Vibrio cholerae O395
Pathway
vcr00040  Pentose and glucuronate interconversions
vcr00052  Galactose metabolism
vcr00500  Starch and sucrose metabolism
vcr00520  Amino sugar and nucleotide sugar metabolism
vcr01100  Metabolic pathways
vcr01130  Biosynthesis of antibiotics
Module
vcr_M00362  Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:vcr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    VC395_0439 (galU)
   00052 Galactose metabolism
    VC395_0439 (galU)
   00500 Starch and sucrose metabolism
    VC395_0439 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    VC395_0439 (galU)
Enzymes [BR:vcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     VC395_0439 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 Smr
Motif
Other DBs
NCBI-ProteinID: ACP08460
Position
I:complement(470067..470942)
Genome map
AA seq 291 aa AA seqDB search
MMIKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVDEAIQAGITGMCIVTGRGK
HSIMDHFDMNYELEHQIRGTNKEELLGDIRKIIESANFTFIRQREMKGLGHAILTGKELV
GDEPFAVVLADDLCVNEEQGVLAQMVALYKQFRCSIVAVQEVPENETHKYGVIAGEMIKD
DLFRVDNMVEKPEPGTAPSNLAIIGRYILTPDIFDLIEQTEPGKGGEIQITDALLKQAKA
GCVLAYKFKGKRFDCGSVEGYIEATNFCYENMYKKNDQKVELAKKSTHKGQ
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgatgattaagaagtgtctatttccggcagctggctacggtacccgattcctaccagcg
actaagtcgatgcccaaagagatgatgcctgttgttaacaaaccgctgattgagtacggt
gttgatgaagcgattcaagcgggtatcacaggcatgtgtattgtgacaggtcgtggtaag
cattcgatcatggatcactttgacatgaactacgagttagagcaccaaatccgcggtacg
aataaagaagagctattgggtgatatccgtaaaatcatcgaaagcgctaactttactttt
attcgccaacgcgaaatgaaaggcttgggtcacgctatcttaacgggcaaagagctggtc
ggtgatgagccgtttgccgttgtgctagcggacgacctgtgtgtgaacgaagagcaaggc
gtactggcacagatggttgcactgtacaaacagttccgctgctctatcgtcgctgtgcaa
gaggttccagaaaacgaaactcacaaatacggcgtgatcgcaggtgagatgatcaaagac
gatctgttccgcgtcgataacatggtcgaaaaaccagagccgggcacagcgccaagcaac
ctcgccatcattggccgttatatcctcacgccagatatttttgatctgattgagcagacc
gagccgggcaaaggcggtgaaattcaaatcactgacgcgctgctcaaacaagccaaagcg
ggttgtgtactggcttataaattcaaaggtaagcgcttcgactgtggtagcgttgaaggc
tatatcgaagccaccaacttctgctacgaaaacatgtacaagaaaaacgaccaaaaagtg
gagttggctaaaaagtcgacgcacaaaggtcagtaa

DBGET integrated database retrieval system