KEGG   Vibrio cholerae O395: VC395_0498Help
Entry
VC395_0498        CDS       T02099                                 

Definition
glutaminase family protein
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
vcr  Vibrio cholerae O395
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:vcr00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:vcr00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:vcr00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:534843..535793
Genome map
AA seq 316 aa AA seqDB search
MRQTNNKESTMKPTAEILASIIEEVRPLTGQGKVADYIPALAKVPSEKLGIAVFTNQGEV
ISAGDAQEGFSIQSISKVLSLTLAMGLYQPNELWSRVGKEPSGQAFNSLIQLEMEHGIPR
NPFINAGAIVVCDMLQSRLSAPRQRLLEFVRQLSGEPLIAYDKVVAASEMMHSDRNAAIA
YLMRSFGNFHNEVIPVLHNYFHACALKMSCVELAKTFSYLANKGVSVVTGETVITPTQSK
QTNALLATCGLYDGAGEFAYRVGMPGKSGVGGGIIAVVPGEMTIAVWSPALDQSGNSLAG
TRALELLAQRIGRSIF
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
ttgagacaaactaataataaagagtcaaccatgaagccaacagcagagattttagccagc
attattgaagaagttcgcccgctcactgggcagggtaaagtcgccgattacattcccgca
ctcgccaaagtaccaagtgaaaagttgggcatcgccgtattcaccaaccaaggggaagtg
atctcggccggtgatgcgcaggaagggttttcgattcagtcgatctccaaagtgctgagc
ttgacgctcgcgatgggcttatatcagccaaatgaactgtggagccgcgtgggtaaagag
ccttcggggcaagcatttaactcattgattcagcttgagatggagcatggaattccgcgt
aatccatttatcaatgccggcgcgattgtggtgtgcgacatgctgcaaagtcgcctctct
gcacctcgtcagcgtctgttggagtttgtacgccaactcagcggtgagccgctcattgct
tatgacaaagtcgtggcagcatcggagatgatgcacagtgatcgcaacgcggcgattgcc
tatttgatgcgttcttttggcaatttccacaatgaggttattccggtactgcacaactat
tttcacgcctgcgcattgaaaatgagctgtgttgagctggcgaaaaccttcagctatctt
gccaacaaaggtgtttctgtggtgacgggggaaacggtgatcaccccaacccaaagcaaa
caaaccaatgccttactcgccacgtgcggcttgtatgatggggcaggagaatttgcctat
cgagttggtatgcccggaaaatcaggtgttggcggtgggattattgctgtggtgccggga
gaaatgacgattgcagtgtggtcccccgcgctggatcaatcgggtaactcgctcgcgggg
actcgcgcgttagagttactcgcgcagcggattggtcgctcaattttctaa

DBGET integrated database retrieval system