KEGG   Vibrio cholerae O395: VC395_0542Help
Entry
VC395_0542        CDS       T02099                                 

Gene name
folK-1
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
vcr  Vibrio cholerae O395
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vcr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VC395_0542 (folK-1)
Enzymes [BR:vcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     VC395_0542 (folK-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:580483..581070
Genome map
AA seq 195 aa AA seqDB search
MAPHPLDQAGRSAASQRSRRDHRASAWMITAYIGVGSNQDRHQSIEAGLRALAELASQWR
LSTIYECPSVGFASHPFFNLMVEMETELALPELMKQLKAIELRCGRLPNAQKYQDRTLDL
DIVLYGDCVSENDPVLPRPDIYRYPFVIQPLYELCPQRVIAGDGRTVEQIWQQAQDLASL
TPVPIWFSINEKKQS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
ttggctccgcatccgcttgaccaagccgggcgcagtgccgcaagccaaaggagtcggcgt
gatcatcgagcgagcgcgtggatgatcaccgcttatattggtgtgggctcaaatcaggat
cgccatcagtcgattgaagctggccttcgtgcattagccgagctggcgagccagtggcgt
ctgtccacgatttatgagtgtccatccgttgggtttgccagccatcctttcttcaatctg
atggttgagatggagacagagctcgcgctgcctgaattgatgaagcagttaaaagcgatc
gagctgcgttgtggccgtttgccgaatgcacaaaagtatcaggatcgaacactggatctt
gatattgtgctgtatggcgattgtgtatcggagaatgatccagtgctgcctcgaccggat
atctatcgctatccgtttgtgattcaacctttatatgagctctgtccgcagcgagtgatt
gctggtgatggtcgaactgttgagcagatttggcaacaagcgcaggatttagcatcactc
accccagtaccgatctggttttctattaacgagaagaaacaatcatga

DBGET integrated database retrieval system