KEGG   Vibrio cholerae O395: VC395_0709Help
Entry
VC395_0709        CDS       T02099                                 

Gene name
exoII
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
vcr  Vibrio cholerae O395
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:vcr00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:vcr00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:762070..763062
Genome map
AA seq 330 aa AA seqDB search
MGPLWLDVAGYELSAEDREILQHPTVGGVILFGRNYHDNQQLLALNKAIRQAAKRPILIG
VDQEGGRVQRFREGFSRIPPAQYYARAENGVELAEQGGWLMAAELIAHDVDLSFAPVLDM
GFACKAIGNRAFGEDVQTVLKHSSAFLRGMKAVGMATTGKHFPGHGAVIADSHLETPYDE
RETIAQDMAIFRAQIEAGVLDAMMPAHVVYPHYDAQPASGSSYWLKQVLREELGFKGIVF
SDDLSMEGAAVMGGPVERSHQALVAGCDMILMCNKREAAVEVLDNLPIMVVPQATALLKK
QQFSYSELKRLDRWQQASANMQRLIEQFSV
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgggaccgctttggttggatgtggccggttacgaactgagtgccgaagatcgcgaaatt
ctgcagcaccctacagtgggtggtgtgattctgtttggtcgcaactatcacgataaccag
cagttgctggcgcttaataaagcgatccgccaagcggcgaaaagaccgattttgattggt
gtcgatcaagaaggtggccgcgtgcagcgtttccgtgaaggcttttctcgcattccccct
gcgcagtattacgcgcgtgctgagaatggcgttgagcttgctgagcagggcggttggttg
atggcggcagagctgattgcacacgatgtcgatttaagttttgcgcctgtgcttgatatg
ggctttgcgtgcaaagcgattggcaaccgtgcttttggtgaagatgttcaaactgtactt
aagcacagcagtgcttttctgcgcggcatgaaagccgtcggtatggcgaccacaggcaaa
cattttcccggtcatggcgcggtgattgccgattcgcatttagagaccccttacgatgag
cgggagacgattgcgcaagatatggcgattttccgtgcgcaaattgaagctggagtgttg
gatgctatgatgccagcgcatgtggtgtatccgcattacgatgctcaacccgcgagcggt
tcgagctactggctaaaacaagtgttacgtgaagaactcggctttaaaggcatcgtattt
tcggatgatttgagcatggaaggcgcagccgtaatgggggggccagttgagcgctcccat
caagctttggtcgccggttgtgacatgattttgatgtgtaacaagcgtgaagcggcagtc
gaagtgctggataaccttccgatcatggtagtgcctcaagccacagcactgctgaaaaaa
cagcaattcagctacagtgagctgaagcgtttagatcgttggcagcaagcgtcagccaat
atgcagcgcttaatcgagcagttctccgtatag

DBGET integrated database retrieval system