KEGG   Vibrio cholerae O395: VC395_0751Help
Entry
VC395_0751        CDS       T02099                                 

Gene name
aceB
Definition
(RefSeq) malate synthase A (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
vcr  Vibrio cholerae O395
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vcr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VC395_0751 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VC395_0751 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    VC395_0751 (aceB)
Enzymes [BR:vcr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VC395_0751 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
I:811078..812748
Genome map
AA seq 556 aa AA seqDB search
MFLVSVSRKEFMSINTAELTQHTTETKITQGKLAVVGTLSPEHQAIFPVEAQTFLQQLCE
RFAPRVDELLNLREQKQTLIDQGQLPDFLAETKDIREGSWKILGIPDDLQDRRVEITGPI
DRKMVINALNANVKVFMADFEDSMSPAWDKVLDGQINLRDAILGCISYTNPDNGKRYELN
ANPAVLICRVRGLHLKEKHVTYNGLAIPSSLFDFALYFYNNHRALLKKGSGPYFYLPKLQ
AYQEAQWWSDVFHFTEDYFGLDTGTIKATVLIETLPAVFQMDEILFSLKEHIVGLNCGRW
DYIFSYIKTLKKHPDRVLPDRQVVTMDKPFLNAYSRLLIYTCHKRGAFAMGGMAAFIPAK
DPALNEQVLQKIRGDKMLEATNGHDGTWVAHPGLADTAMAVFNEVLGERKNQLNVSRMAD
APITAADLLAPCDGPRSEHGMRHNIRVALQYIEAWISGNGCVPIYGLMEDAATAEISRAS
IWQWIQHGKTLDNGQVVTNELFRDYLKQEIEVVKSEVGESRFAQGRFTEAAELMERLTTS
QELPNFLTIPGYDYLP
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgttcttggtgagtgtttcaaggaaggaatttatgtcaatcaatactgctgaattaacc
caacacaccacggaaaccaaaatcacccaaggcaagcttgctgtggtgggtaccctttca
cccgaacatcaagcgattttccctgtcgaagcccaaacttttttacagcaactctgtgag
cgctttgcgccgcgagttgatgaattgctgaacttgcgtgaacaaaaacaaacgcttatc
gaccaaggccagctacctgattttcttgccgaaaccaaagatatccgtgaaggaagctgg
aagattctcggcattccagacgatctgcaagatcgtcgcgtagagatcacggggccaatc
gatcgcaaaatggtgattaatgcactgaacgcgaatgtgaaagtctttatggctgacttt
gaagattcgatgtcgcccgcgtgggacaaggtgttggatgggcagatcaacctgcgtgat
gcgattctgggctgcataagctataccaacccagataatggcaagcgttatgagctcaat
gccaacccagcggtgcttatctgccgcgtgcgcggtctgcatctcaaagaaaaacatgtc
acttacaacggcttggcgattcccagttcactgttcgattttgcgctctatttttacaac
aaccatcgcgcactgttgaaaaaaggcagtggcccttatttctacctacctaagctgcaa
gcttatcaagaggcgcagtggtggagtgacgtgttccatttcacggaagattattttggt
ttagacacaggcaccatcaaagcaacagtgttgattgaaactctgcctgcggtatttcag
atggatgagatcctcttctcactcaaagagcacattgtcggtctgaactgtggacgctgg
gattatattttcagctacatcaaaaccttgaaaaagcatcccgaccgcgtattgccggat
cgccaagtggtgaccatggataagcctttcctcaatgcgtattcccgtttgttgatttac
acctgtcataaacgcggcgcgtttgcgatgggcgggatggcggcgtttattccagccaaa
gatcctgcgctcaatgagcaagtgctacaaaaaattcgcggcgacaaaatgcttgaagcg
accaatggccacgatggcacttgggttgctcaccccggtttagcggataccgcgatggcg
gtgtttaacgaagtgcttggtgagcgcaaaaaccaactcaatgtaagccgaatggccgat
gctccgataaccgcggccgatctattggcaccttgcgatgggccacgctctgagcatggc
atgcgccacaacattcgcgttgcgttgcaatacatcgaagcatggatttctggtaacggt
tgtgtgccgatctacggcttgatggaagatgcggcgacagcggagatttcacgcgcttcg
atttggcaatggatccaacacggcaaaacgttagataacgggcaagtggtcactaacgaa
ctgtttcgcgactacctcaaacaagagattgaggtggtgaaaagtgaagtgggtgagtcc
cgttttgcacaagggcgttttactgaagcggccgaattgatggagcgcttaacgaccagt
caagagctaccgaatttcttaaccataccgggctacgactacttgccgtag

DBGET integrated database retrieval system