KEGG   Vibrio cholerae O395: VC395_0753Help
Entry
VC395_0753        CDS       T02099                                 

Gene name
aceA
Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
vcr  Vibrio cholerae O395
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vcr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VC395_0753 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    VC395_0753 (aceA)
Enzymes [BR:vcr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     VC395_0753 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:812878..814191
Genome map
AA seq 437 aa AA seqDB search
MTLTRRQQIEALEKDWATNPRWKNVKRTYTAEEVVSLRGSVVPANTIAQRGADKLWELVN
GSAKKGYVNCLGALTGGQAVQQAKAGIEAIYLSGWQVAADNNTAGTMYPDQSLYPVDSVP
SVVRRINNAFRRADQIQWSNGKSPQDEGGIDYFLPIVADAEAGFGGVLNAYELMKSMIEA
GAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLIAARLAADVAGTTTLVIARTDANAA
DLLTSDSDPYDADFVTGERTSEGFYRVRAGIDQAISRGLAYAPYADLVWCETAKPDLEEA
RKFAEAIHAQYPDQLLAYNCSPSFNWEKNLDAKTIAHFQQALSDMGYKYQFITLAGIHNM
WFNMFELAHAYAQGEGMRHYVEMVQRREFEAASKGYTFVAHQQEVGTGYFDKMTNTIQGG
NSSVTALTGSTEEDQFH
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgacactgactcgtcgccaacaaattgaagcactagaaaaagattgggcaaccaaccca
cgctggaaaaatgtgaaacgcacttacaccgctgaagaagtggtgagtttgcgcggctcg
gttgtaccagccaataccatcgcccaacgtggtgcagacaaactgtgggaactggtgaat
ggttcagcgaaaaaagggtatgtgaactgtttgggcgcactcactggcggccaagcggtg
caacaagccaaggcgggcattgaagcgatttatctctctggctggcaagtggcggcggat
aacaacaccgcaggcaccatgtacccagaccaatctctctatccagtggattctgtaccg
tcagtcgtacgccgcatcaataatgcgtttcgtcgcgctgaccaaatccagtggtcaaac
ggcaaatcaccacaagatgaaggcggaattgattacttcctgccaatcgtcgcggatgcg
gaagccggttttggtggcgtactcaacgcttatgagttgatgaaatctatgattgaagcg
ggcgctgctggcgttcactttgaagaccaattggcttcggtgaaaaaatgtggccacatg
ggcggcaaagtattggtaccgactcaagaagcggtgcaaaaactgattgcagcacgtttg
gctgccgatgttgcaggcacgactacgttagtgattgctcgcaccgatgctaacgccgcc
gatttgctcacttcagacagcgatccgtacgatgccgatttcgtgaccggtgagcgtact
tccgaaggtttctaccgtgtacgcgcgggcattgaccaagcgatttctcgcggcttggct
tacgcaccttacgcagatttggtgtggtgtgaaaccgcgaagccggatctggaagaagcg
cgtaaatttgctgaagcgattcatgcacaatacccagatcaactgttggcttacaactgc
tcaccgtcgttcaactgggaaaagaatctcgatgcgaaaaccatcgcccatttccagcaa
gcgctgtcggacatgggttacaagtaccagttcatcacgttagcgggtattcacaacatg
tggtttaacatgtttgagttagcgcacgcttacgcgcaaggcgaaggtatgcgtcactat
gtcgaaatggtacagcgtcgcgaatttgaagcagcatccaaaggttataccttcgtggcg
caccaacaagaagtggggacgggttacttcgataagatgaccaacaccattcaaggcggc
aacagttcggtgacggctctgaccggctcaaccgaagaagatcaatttcactaa

DBGET integrated database retrieval system