KEGG   Vibrio cholerae O395: VC395_1061Help
Entry
VC395_1061        CDS       T02099                                 

Gene name
yfcX
Definition
fatty oxidation complex, alpha subunit
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
vcr  Vibrio cholerae O395
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vcr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VC395_1061 (yfcX)
   01212 Fatty acid metabolism
    VC395_1061 (yfcX)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    VC395_1061 (yfcX)
   00650 Butanoate metabolism
    VC395_1061 (yfcX)
  Lipid metabolism
   00071 Fatty acid degradation
    VC395_1061 (yfcX)
   01040 Biosynthesis of unsaturated fatty acids
    VC395_1061 (yfcX)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VC395_1061 (yfcX)
   00310 Lysine degradation
    VC395_1061 (yfcX)
   00380 Tryptophan metabolism
    VC395_1061 (yfcX)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VC395_1061 (yfcX)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    VC395_1061 (yfcX)
   00281 Geraniol degradation
    VC395_1061 (yfcX)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    VC395_1061 (yfcX)
Enzymes [BR:vcr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     VC395_1061 (yfcX)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     VC395_1061 (yfcX)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     VC395_1061 (yfcX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1138298..1140472
Genome map
AA seq 724 aa AA seqDB search
MCCGWLRRCYDSGGGIMDNNNAFQLSFDEQHYAWLAIDVPGEKMNTLQAAFAEEMQAVFA
TLNEKRGQIKGLIIHSLKPDNFIAGADVRMLEACQSVHEAQALASQGQQMFQQLADLPFP
VVAAIHGPCLGGGLELALACDYRVCTEDEVTRLGLPEVMLGLLPGSGGTQRLPRLIGLLP
ALDLILTGKQLRAKKAKKLGVVDACVPHSVLLDVAKRLLEEKGHKKRAQVTLPIKEKLLA
NTGLGRKLIFDQAAKKTQQKTRGNYPAAQAILEVIQYGLEKGMHAGLEYEAKRFAELVMT
RESKALRSIFFATTEMKKDLGADAKPAPVAAVGVLGGGLMGAGISHVTVAKAKTSVRIKD
VANDGVLNALNYNYKLFDKQRQRKILTKAQLQAQMSQLSGGTGFVGFDRCDVVIEAVFED
LKLKQQMVADIEANAKPTTIFATNTSSLPIHQIASQAQRPQNIVGLHYFSPVEKMPLVEV
IPHATTSDETIATVVTLARKQGKTPIVVKDCAGFYVNRILAPYMNEAAQVLMAGEPIEKL
DAALLDFGFPVGPITLLDEVGVDIGAKIMPILVKELGPRFQGPDVFDVLLKDNRKGRKSG
KGFYTYKGSKKKEVDKSVYKLLKLTPESKLNDKEIAMRCLLPMLNEAVRCLDEGIIRSAR
DGDMGAIFGIGFPPFLGGPFRYMDTLGLTKVVEMMNQHTEKYGERFAPCDGLLTRAGLGE
KFYP
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
ttgtgctgcgggtggcttaggcgctgctatgattctggaggtggaataatggataacaac
aatgcatttcagctctcgtttgatgagcagcattacgcttggctggcgattgatgtcccg
ggcgaaaaaatgaataccctgcaagcggcatttgcagaagagatgcaagccgtttttgca
acgctcaatgaaaaacgaggacagatcaaagggctgattatccactctcttaagccggat
aactttattgcgggtgcggatgtccgcatgttggaagcttgccaatcggtacatgaagca
caagcgttagcctcgcaggggcaacagatgttccagcagcttgccgatttgcctttccct
gtggtcgcggcgattcacggcccttgcttaggcggtggtttagaattggctctggcgtgt
gattatcgtgtctgtactgaagatgaggtaacacgtctaggcttaccagaagtgatgttg
ggtttgcttccgggctctggcggtacgcagcgtttaccacgtttgattggtttactgcct
gcgctggacctcatcttaacgggcaaacaattgcgtgccaaaaaggccaagaaattgggt
gtggttgatgcatgtgttccgcactcagtactgttggatgtggccaaacgtcttctagaa
gaaaaagggcacaaaaagcgcgctcaagttacgctaccgatcaaagaaaaactgctcgcc
aataccggcttggggcgtaagttgatttttgaccaagcggccaagaaaacgcagcagaaa
acgcgtggtaactaccccgcagcgcaagccattttagaggtcattcagtatggcctagaa
aaagggatgcatgctggcttggaatatgaagccaagcgtttcgctgaattggtgatgacc
cgagaatcgaaagcactgcgctccattttctttgcgaccacagagatgaaaaaagatctc
ggtgcggatgccaaacccgcacctgtggcggctgtgggcgtgctcggtggtggtttgatg
ggggctggcatcagtcacgttactgtggcgaaagccaaaacatcggtgcgcatcaaagat
gtggcgaatgatggtgtgctcaatgccctcaattacaactacaagctgtttgataagcag
agacagcgcaagattttgactaaagcacagctgcaagcgcagatgtcgcagctctcgggt
gggactggctttgtgggttttgatcgctgtgatgtagtgatagaggctgtgtttgaagac
ctgaaacttaagcaacaaatggtggcggatattgaagcgaatgccaaaccgacaacgatt
tttgcgaccaacacatcctcgctgccgatccatcagatcgcgagccaagcgcagcgtccg
caaaatattgtgggtttacattatttcagcccagttgaaaaaatgccgttggtggaagtg
attcctcacgcgaccacctcggatgaaaccattgcgaccgtggtgacattggcacgtaag
cagggcaaaacaccgattgttgttaaagactgtgctggtttttatgtcaaccgcatttta
gcgccttatatgaatgaagccgcgcaagtgctgatggcgggtgaacctatcgaaaaactc
gatgctgcgttactggattttggtttcccagtggggcctatcaccttgcttgatgaagta
ggggtcgatatcggagccaagatcatgccgattttggttaaagagcttgggccgcgtttc
caaggaccggacgtctttgatgtgcttttgaaagataaccgtaaaggccggaaaagcggt
aaaggtttctacacctacaaaggcagcaagaagaaagaagtcgataaatccgtttataaa
ctgctgaagttaaccccggaatctaagctaaacgacaaagaaatcgcgatgcgttgcttg
ttgcctatgctcaatgaggcggttcgttgtctcgatgaaggcattattcgcagtgcacgt
gatggcgatatgggcgcgatttttggcatcggtttcccgccgttcttaggtgggcctttc
cgttacatggacacgcttggtttaaccaaagtggtggaaatgatgaaccaacacaccgag
aaatatggagagcggtttgctccatgtgacggtttgttgacgagagcgggattgggcgag
aagttctacccctag

DBGET integrated database retrieval system