KEGG   Vibrio cholerae O395: VC395_1289Help
Entry
VC395_1289        CDS       T02099                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vcr  Vibrio cholerae O395
Pathway
vcr00260  Glycine, serine and threonine metabolism
vcr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vcr01100  Metabolic pathways
vcr01110  Biosynthesis of secondary metabolites
vcr01130  Biosynthesis of antibiotics
vcr01230  Biosynthesis of amino acids
Module
vcr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vcr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VC395_1289 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VC395_1289 (trpB)
Enzymes [BR:vcr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VC395_1289 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACP09297
UniProt: A5F208
Position
I:complement(1332943..1334133)
Genome map
AA seq 396 aa AA seqDB search
MAKLNAYFGEFGGQFVPQILVPALDQLEQAFIDAQQDDAFRAEFMSLLQEYAGRPTALTL
TQNITKGTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKHEIIAETGAGQHGVATAL
ACALLGLKCRVYMGAKDVERQSPNVFRMRLMGATVIPVHSGSATLKDACNEALRDWSASY
ETAHYLLGTAAGPHPFPTIVREFQRIIGEETKNQILAREGRLPDAVIACVGGGSNAIGMF
ADFIEEESVRLIGIEPAGKGIHTHQHGAPLKHGKTGIFFGMKAPLMQDEHGQVEESYSVS
AGLDFPSVGPQHAYLNAIGRAEYESITDDEALDAFQALARNEGIIPALESSHALAHAIKM
AYAEPDKEQLLVVNLSGRGDKDIFTVHKLLEDKGAL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaattaaacgcctattttggcgaattcggtgggcagtttgtgccacaaattttg
gttccggcactcgatcaactggaacaagcttttattgatgcccagcaggatgatgctttt
cgcgctgaatttatgagcctactgcaagagtacgcgggtcgccccactgcgctgacactc
acgcaaaacatcaccaaaggcaccaaaaccaaactctatttgaagcgtgaagatctactg
cacggcggcgcgcacaaaaccaaccaagttttgggccaagccctgctcgccaaacgtatg
ggcaaacatgaaattatcgccgagacaggcgcaggtcaacacggtgtcgcaaccgcatta
gcctgtgcactgcttggcctaaaatgccgcgtgtacatgggtgcaaaagacgttgagcgc
caaagcccaaacgtgttccgtatgcgcttaatgggtgccaccgtgatccctgttcattca
ggttcagcaacgctaaaagatgcctgtaacgaagcgctgcgtgactggtcagccagctat
gaaactgcgcattatctgctcggtactgcggcaggccctcacccattcccaaccatagtg
cgtgaattccaacgcattattggtgaagaaaccaaaaaccaaatccttgctcgtgaaggt
cgtttgcccgatgcggtgatcgcttgtgtcggtggcggctcaaacgcgattggtatgttt
gccgatttcatcgaagaagaatccgtacgtttgatcggtattgagccagcaggtaaaggc
attcatacccatcaacatggtgcaccactcaaacacggtaaaactggtatcttcttcggc
atgaaagcaccgttgatgcaagatgaacatggtcaagtggaagagtcttactctgtctct
gcggggctggatttcccatcggtgggtccacaacatgcttacctcaacgccattggtcgt
gcggaatatgaaagcattaccgatgatgaagcactcgatgcgttccaagcgttggcacgt
aacgaaggcatcattccagcgctggagtcttcacacgctctcgcgcatgcaatcaaaatg
gcgtatgccgaaccagacaaagagcagttgctcgtggttaacctttcgggccgaggtgat
aaggatattttcaccgtacacaaattacttgaagacaaaggagcgttgtaa

DBGET integrated database retrieval system