KEGG   Vibrio cholerae O395: VC395_1290Help
Entry
VC395_1290        CDS       T02099                                 

Gene name
trpC_F
Definition
(GenBank) indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
vcr  Vibrio cholerae O395
Pathway
vcr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vcr01100  Metabolic pathways
vcr01110  Biosynthesis of secondary metabolites
vcr01130  Biosynthesis of antibiotics
vcr01230  Biosynthesis of amino acids
Module
vcr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vcr00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VC395_1290 (trpC_F)
Enzymes [BR:vcr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     VC395_1290 (trpC_F)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     VC395_1290 (trpC_F)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ACP09298
Position
I:complement(1334174..1335583)
Genome map
AA seq 469 aa AA seqDB search
MSEQLSEHISVQTAQMAQVLVKIVNDKYQWIEERKAKQPLASFHPLLTRSERDFYQALSG
DNTVFILECKKASPSKGLIREEFDLDYIASVYGEYASAISVLTDEKYFQGRFEFLPQVRA
QVAQPVLCKDFMVDPYQVYLARHYQADAILLMLSVLNDDQYRELAAVAHDLGMGVLTEVS
NEQELKRAVDLQAKVIGINNRNLRDLTTDLNRTKQLAPLIPQGTIIISESGIYTHQQVRD
LAEFANGFLIGSSLMAQSNLELAVRKIVLGEHKVCGLTHPDDAVKAYQAGSVFGGLIFVE
KSKRFVDVEQARLTMSGAPLQYVGVFQNHPAAQVADIATKLGLFAVQLHGEEDSAYVSEL
RASLPESIEIWKAYGVSDALPELLPEHIDRHLLDAKVGEQSGGTGRSFDWRLLPKHSDLM
LAGGLSAENVAQAAQLGCRGLDFNSGVESAPGKKDANQLQQVFQQLRNY
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagcagttgtctgagcatatttccgtacaaaccgcgcaaatggcgcaagtgctg
gtcaaaatcgtcaacgataaataccaatggattgaagagcgcaaagccaagcaacctctt
gctagctttcatccattactgactcgctcagagcgcgatttctatcaagccttgagcggc
gataacaccgtattcattctcgaatgcaaaaaagcctcaccttcaaaaggattgatccgc
gaagagtttgatctcgattacatcgcctctgtgtatggcgagtacgccagtgccatttcg
gtactgactgacgagaaatatttccaaggtcgttttgagtttttgccgcaagtgcgcgct
caagtggctcagcctgtcttgtgcaaagattttatggtcgacccgtatcaggtttatctg
gcgcgtcattatcaagcggatgcgattttgctgatgctgtctgtgctcaatgatgatcaa
tatcgtgaactggctgctgtggcgcacgaccttggtatgggcgtactcaccgaagtcagc
aacgaacaagaattgaaacgtgcagttgatctgcaagcgaaagtcatcggcatcaataac
cgcaatctgcgtgatttgaccaccgacctaaatcgcaccaagcagttggcgccgctcatt
ccacaaggcaccatcattatttccgaatccggtatttatacccatcagcaggtgcgtgat
ttggctgaatttgccaatggtttcttgattggtagctcgctgatggcgcaaagcaatctt
gaactggcggtgcgaaaaattgtgctaggtgaacataaggtgtgcggtttgactcatcct
gatgatgcggtgaaagcctaccaagccggttccgtttttggtggattgatttttgttgag
aagtccaaacgctttgtcgatgtagaacaagctcgcctgaccatgagcggcgcgccgcta
cagtatgtcggcgtgtttcaaaatcacccagcagcacaagtcgccgatattgcaaccaaa
cttggcttatttgcggtgcaactgcacggtgaggaagactctgcgtatgtaagcgaactg
cgcgcttcccttccagaatccattgaaatttggaaagcgtatggcgtgagtgatgcttta
cctgagctactaccagagcacatcgataggcatctgctcgatgccaaagtcggcgaacag
agtggcggcacaggacgcagttttgattggcgcttgctgccaaaacatagcgacctgatg
ctcgccggcggcttgagcgccgagaatgtcgcccaagcggcgcaacttggctgccgcgga
ctcgatttcaactctggcgtggaaagcgctccgggtaaaaaagacgccaaccagttacaa
caggttttccaacagttacggaattattag

DBGET integrated database retrieval system