KEGG   Vibrio cholerae O395: VC395_1808Help
Entry
VC395_1808        CDS       T02099                                 

Gene name
galA
Definition
Alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
vcr  Vibrio cholerae O395
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:vcr00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:vcr00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:vcr00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1907323..1909059)
Genome map
AA seq 578 aa AA seqDB search
MSHLRLANGREILVQQADIELEIAGNELFARYIGLHNRPFERRYPLFSTLLDVESDARLV
GDGFQMLSQASGTLSHIQEVGRCPDNNLSYRIYPHDAPKRFYNTLMIEAAGRYLLFGFTS
CQRFAGFFEVLRHPQHWVLSAFIDGEETRPQDWITNQLESVICLEGESMSELYQAYAEAI
SRHHPPRPHLKDPAPMGWCSWYAYYAEVTEQDIKENVAILAERHPELEWVLLDDGYQAFM
GDWLTPSQKFPSGIQQVVADIRAQGKKPAIWLAPFIAEADSAVFRQHPDWFVKNAAGQPL
KAEEITYGGWRCTPWYVLDGSHPDVQEHLTQVVKTLREEWGVELFKLDANYWGTLQGQRF
QSGVTGVEAYRMGMQAIAEGAGDGWLLGCNAPMWPSLGLVDAMRVSDDVERNADRFCQIA
RETLMRSWQHRQLWQIDPDCLTLTSLPNQSADRASYEFHRNLLLASGGLLLSGDPLPKLT
PFAKQSLKRLLKRFQYSQKAAKITSLSMRHAFLPLTDKNDLHCLFNFNGKAQEFTLVANH
PVQWYDYWTGEQLSSEPSKLLIVNLEKGLQSRAIFTVG
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgagccatctcagattagcgaatgggcgagaaatcctagtgcagcaagcggatattgag
ctggagatcgcaggcaatgagctttttgctcggtatatcgggttacacaatcgacctttt
gagcgccgttatccactgtttagcactttactggatgtcgaatcggatgcccgcttagtg
ggggatggctttcaaatgctgtcgcaagcctcaggtacgctaagccatatccaagaagtt
ggacgatgtccagataacaatctcagttaccgcatctacccgcatgatgcgccaaagcgt
ttttacaataccttgatgatagaggccgctggccgctatctgttgtttggctttacttct
tgccagcgttttgcgggcttttttgaagtgctccgtcacccgcagcattgggtgttaagc
gcgtttattgatggagaggaaacccgcccacaagactggatcaccaatcaattggaatcg
gtgatttgcttagaaggcgaatccatgtcagagctttaccaagcctatgccgaggcgatc
tctcgccaccatccgccaagaccccatctcaaagatcccgcaccaatgggctggtgttct
tggtacgcctattatgcagaggtgaccgaacaagatatcaaagagaatgtcgcgatattg
gcggagcgtcacccagaattggaatgggtgctgctggatgacggctatcaagcgtttatg
ggcgattggctcacaccatcccaaaaatttcccagtggtattcagcaagtggttgccgat
attcgagcccaaggtaaaaagcccgccatttggctcgcgccttttatcgcggaagcggat
tcagcggtctttcgtcagcatccggactggtttgtgaaaaatgccgcaggtcagccactc
aaagccgaagagatcacttatggcggttggcgctgtacgccttggtatgtgttggatggt
tctcatccggatgtgcaagagcacttgacccaagtggtgaaaaccctgcgtgaagagtgg
ggcgttgaactgtttaagctggatgccaactactggggaacgctacaaggccagcgtttt
caatcgggtgttacgggtgtagaagcgtatcgaatgggcatgcaagccatcgcggaaggc
gcaggcgatgggtggctactcggttgtaatgcgccgatgtggccttcactgggtttggtg
gatgcaatgcgtgtgtcggatgatgtagagcgcaatgccgatcgcttttgccaaattgcg
cgtgaaaccttaatgcgcagttggcagcaccggcaactgtggcaaatcgatccggattgc
ttaacgctcacctcgctgcccaatcaaagtgccgatcgcgccagctacgaattccaccgt
aatttgctgcttgccagtggtggtttgctattgtcaggcgacccactgccgaaattaaca
ccgtttgcaaaacagagcctgaaacgtttactcaaacgattccaatacagtcagaaggcg
gccaaaatcacttccttgagtatgcgccatgccttcttaccgctgaccgataaaaatgat
ctgcactgcttgtttaacttcaacggtaaagctcaggagtttaccttggtcgccaatcat
ccggtgcaatggtatgactattggacaggagagcaattaagcagcgaaccttccaaactg
ctcatcgttaacttagagaaggggttacaaagccgcgccatttttacagtgggttaa

DBGET integrated database retrieval system