KEGG   Vibrio cholerae O395: VC395_2116Help
Entry
VC395_2116        CDS       T02099                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
vcr  Vibrio cholerae O395
Pathway
vcr00010  Glycolysis / Gluconeogenesis
vcr01100  Metabolic pathways
vcr01110  Biosynthesis of secondary metabolites
vcr01120  Microbial metabolism in diverse environments
vcr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vcr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VC395_2116
Enzymes [BR:vcr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     VC395_2116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim DUF4766 DUF4352
Motif
Other DBs
NCBI-ProteinID: ACP10108
Position
I:2237920..2238810
Genome map
AA seq 296 aa AA seqDB search
MDLLSLKTVTTLSDCVTIAEQDQVKIVRVIHDKASAAISLHGGHVLSFQPKGQADLLWMS
SQAIYDGKAALRGGIPVCWPWFGRIAAPAHGFARNQEWKLIEHRENEQGVIVTLGLQATP
ESLAIWPYQFDVRLHVEIRESLTVTLDVTNTDSKAWTFSGALHTYLHVGDIRETQTSGVG
TEYIDSLQNSRLCTQHGLLTLTDAIDRVYTQPEPLITVQDPALARTLTVENQGHNSAVLW
NPWQQGAQSMADMNDEGYLHFLCVESTLHAPSLAEGITLQPGQNHQLVTQITSQAQ
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggatttactctctttgaaaaccgtcacaacattgtctgattgcgtcaccatagctgag
caagatcaagtcaaaatcgtacgcgtcattcatgacaaagccagcgccgctatctcacta
cacggtggccatgtcctctcctttcagccaaaaggtcaagctgacttgctgtggatgagc
tcacaagctatttacgatggcaaagccgcactacgcggtggtattccggtttgctggcca
tggtttggtcgtattgccgccccggcacatggttttgcacggaaccaagaatggaaactg
atcgaacacagggaaaatgagcaaggcgttatcgtcactctcggcttgcaagccacgcca
gagagcttagccatttggccatatcaatttgacgttcgattgcacgtggaaatccgtgag
agcttgactgtgacacttgatgtgactaacacggattcaaaagcatggaccttctctggg
gctctgcacacttatctgcacgtgggtgatattcgtgaaacgcaaacctcaggtgtggga
acggagtatattgatagcctacaaaacagtcgtctatgtactcagcacggtttgctcact
ctcactgacgcgatagaccgtgtttacacgcaacccgaacccttgatcacagtgcaagac
cccgcattagctcgcacgctaaccgttgaaaatcaaggtcataactccgcggtgttgtgg
aatccttggcaacaaggtgctcaatcgatggccgacatgaatgatgagggttacttacac
tttttgtgtgtggaatcaacactgcatgcgccgtctttggcagagggtatcaccttacag
ccggggcaaaatcatcagctagtcactcaaatcactagccaagctcaatag

DBGET integrated database retrieval system