KEGG   Vibrio cholerae O395: VC395_2177Help
Entry
VC395_2177        CDS       T02099                                 

Gene name
cheB-2
Definition
protein-glutamate methylesterase CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
vcr  Vibrio cholerae O395
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:vcr00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    VC395_2177 (cheB-2)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    VC395_2177 (cheB-2)
Enzymes [BR:vcr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     VC395_2177 (cheB-2)
Two-component system [BR:vcr02022]
 CheA family
  CheA-CheYBV
   VC395_2177 (cheB-2)
Bacterial motility proteins [BR:vcr02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    VC395_2177 (cheB-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2300977..2302110)
Genome map
AA seq 377 aa AA seqDB search
MAIKVLVVDDSSFFRRRVSEIINSESRLEVIDVAVNGKEAVEKAARLKPDVITMDIEMPV
MDGISAVREIMANNPVPILMFSSLTHDGAKATLDALDAGALDFLPKKFEDIARNRDEAVT
LLQQRVLSIASKKMFLRRPAAPRPAPTTSIAASSSLSQERAAATSPLGNRPSTAVSAATR
FKASGKKYQLTAIGTSTGGPVALQKILTKLPVNYPHPIVLIQHMPATFTAAFASRLNSLC
KIEVKEAEDGDMLRPGVAYLAPGGKQMMLDGRPGAARLRIIDGGDRMNYKPCVDVTFGSA
AKIFGDKVLSMILTGMGADGREGARMLKQAGATIWAQDEESCVVYGMPQAVAKAGISTED
LPLERIAERMLVEVGLA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcgattaaagtattagttgttgatgattcgagttttttccgtcgtcgcgtgagtgaa
atcatcaactccgaatcgcgcttagaagtcattgatgttgctgtaaatgggaaagaggcc
gtagaaaaggccgctcgactcaagccagatgtgatcactatggatatagaaatgcccgtc
atggacggtatttccgctgtccgagaaatcatggcaaacaatcccgtgcccattttgatg
ttctcttcattgacccatgatggcgcaaaagccacattggatgcactggatgctggcgcg
ttagactttttacctaagaagtttgaagatatcgcgcgcaaccgggatgaagccgtcaca
ctgttacagcagcgtgtgctttctattgcatcgaaaaagatgtttctacgtcgccctgca
gctccacgccctgcgcctacaacatcaatagcagcgagttcgtcactcagccaagaacga
gcggcagctacctcacctttgggaaaccgaccctcgacggcggtttcagcagccactcgt
tttaaagcttcgggtaaaaaataccagttgaccgcaataggaacctcaacaggtggacct
gtagccttgcaaaaaatattaactaagctccccgtaaattatccacaccccatagtgttg
attcagcatatgccagcaacatttacggctgcttttgctagccgtctcaattcgctatgc
aaaattgaagttaaagaagcggaagatggagatatgctgcgtccgggtgttgcttattta
gcaccgggtggtaagcagatgatgctggatggtcgacccggtgcggctcgcctacgtatt
atcgatggtggcgaccgcatgaactataaaccgtgtgtggatgttacttttggctccgca
gcgaaaatctttggtgacaaagtactgtccatgattttgaccggaatgggtgcggatgga
cgtgaaggtgcacggatgctgaaacaagcaggagccaccatttgggcacaagatgaagaa
agttgtgtcgtgtatggcatgccacaagctgtcgctaaagcaggaatttcaacggaagat
ctaccgctggagagaatcgcagagcgtatgttggtagaagtcgggctcgcctaa

DBGET integrated database retrieval system