KEGG   Vibrio cholerae O395: VC395_2205Help
Entry
VC395_2205        CDS       T02099                                 

Gene name
sdhD
Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
vcr  Vibrio cholerae O395
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:vcr01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:vcr00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:vcr00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:vcr00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2336553..2336897)
Genome map
AA seq 114 aa AA seqDB search
MVKHVSSFGRNGVHDYLLIRASAIILVLYTIYIVSFCAFTDISYVAWTQFFGSTFTKVFT
MLALVSVLIHGWIGLWQVLTDYIKCSKLRAGLQLVVIAVLLGYFFSGLFVLWGA
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagcatgtctcttcctttggtcgtaatggtgttcacgattacttattgatccgc
gcttcagcgatcatcttagttttgtacactatttatatcgtgagtttttgcgcgttcacg
gacatctcttatgtcgcgtggactcaattctttggtagcacgttcaccaaagtcttcaca
atgttggcattagtttcagtattgattcatggctggattggcctatggcaagtactgacg
gattacattaagtgctccaaattgcgtgcaggactgcaacttgtggtcatcgccgttcta
cttggatacttcttctctggcctatttgtattgtggggtgcctaa

DBGET integrated database retrieval system