KEGG   Vibrio cholerae O395: VC395_2296Help
Entry
VC395_2296        CDS       T02099                                 

Definition
kinase, GHMP family
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
vcr  Vibrio cholerae O395
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vcr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VC395_2296
Enzymes [BR:vcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     VC395_2296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2411285..2412172
Genome map
AA seq 295 aa AA seqDB search
MDAAPMIHGTTVWPSPAKLNLFLYITGRRANGYHDLQTLFQFLDHGDELTITANNSGNIT
LSPALADVALEDNLIYKAAMALKNAAQSPLGADIQLHKVLPMGGGIGGGSSNAATTLVAL
NYLWQTGLSDDQLAEIGLALGADVPVFTRGFAAFAEGVGEELSAVEPEEKWYLVVRPAVS
IATKDIFTHPQLMRNTPKRDLASLLTTPYENDCEKIVRSLYPEVDKQLSWLLQYAPSRLT
GTGSCVFAEFSSRKDAQAVFAQLSDNVLAFVAQGRNVSPLRKTLADYQSAKIRPY
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggacgctgctcccatgatccacggcacaaccgtgtggccttcaccggccaaactcaac
ctgttcctttacatcacaggtcgtcgagctaacggctatcacgatctgcagaccttgttt
cagtttctcgatcacggtgatgagttaaccattaccgccaacaacagcggcaacatcacc
ctctctcctgctctggccgatgtcgcgttagaagataacctgatttacaaagccgcgatg
gcactcaaaaatgcggcgcaatcaccactcggcgcagacattcaactgcacaaggtgttg
cctatgggcggcggaattggtggcggatcatccaatgcggccactaccttagtcgcactc
aattacttgtggcaaactgggcttagcgatgatcaattggctgaaattgggctggcactc
ggagcggatgtccctgtctttactcgtggttttgcggcttttgctgaaggagttggcgaa
gaattatccgcagtagagccagaggaaaaatggtatctcgtggttcgccctgcggtcagc
atcgcgacaaaagatattttcactcatccacagctgatgagaaacacgccaaagcgtgat
ctggcaagccttcttaccaccccgtacgaaaacgattgcgaaaaaattgtccgatcactg
taccccgaggttgataagcaactttcatggctgctacaatacgcgccgtcaagattgacc
gggacgggatcttgcgtttttgctgagttttcgagcaggaaagatgcacaggccgtcttt
gctcaattatctgacaacgtcttagcgtttgtcgcccaagggcgcaatgtttcaccgctc
agaaagacgttggctgactaccaatcagctaaaatccgaccttactaa

DBGET integrated database retrieval system