KEGG   Vibrio cholerae O395: VC395_2333Help
Entry
VC395_2333        CDS       T02099                                 

Gene name
chb-2
Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
vcr  Vibrio cholerae O395
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vcr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VC395_2333 (chb-2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    VC395_2333 (chb-2)
Enzymes [BR:vcr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     VC395_2333 (chb-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2456248..2458899)
Genome map
AA seq 883 aa AA seqDB search
MLKKSLISIAVFTSLSGCALNTTSPQEVVDTLANNLDVQYQVVNNHGADTGLACQTLEAE
WASCNQVNMTLVNRGEAVNSKDWAIYFHSIRLILDVGNDQFKITRVTGDLHKLEPTDKFD
GFAAGETVTLPLIGEYWTLFETDFMPRAFVTAPDAEPKVIAALNTEDVASFVSGLEGENL
KRTPSDNNVFAQALSRFEKNSDVALQDVTHALIPTPLQVKSHSGSVSIAKGIALPSKAFD
GEQMQALNERAQLLGVNLKGVMPAQVIINPKSFKGDLAKSGAYRLAITDKAVKVTAFDQA
GAFYAMQSLLGLVDMADATQLPKVEIVDAPRFDYRGVMVDVARNFHSKQAILATLDQMAA
YKMNKLHLHLTDDEGWRIEIPGLPELTDIGAQRCFDPSETECVLPQLGSGPNADNFGSGY
FTKQDYLEILQYAKARHIEVIPEIDMPAHARAAVVSMEARYQRLMQEGNEAAANEFRLLD
PQDTSNVTTVQFYDRMSFINPCLDSSKRFVDKVISEIAAMHQAAGMPLTTWHFGGDEAKN
IKLGAGFQDVNTQEPVSWKGNLDLSKQDKPFARSPQCQNLIATGAVSDFGHLPSYFAEQV
SKLVAEKGIPNFQAWQDGLKYSEGEKAFATENTRVNFWDVLYWGGSASAYEWAEKGYDVI
ISNPDYVYMDMPYEADPKERGYYWATRATDTRKMFGFAPENLPQNAETSLDRDGNGFSGK
GEVKGKPFYGLSAQLWSETVRTDEQYEYMVFPRVLAAAERAWHRAEWENAYKVGVEYSQE
TQLVNHKALNADWNRFANVLGQRELAKLEKAGIDYRLPVPGAKIENGHLAMNVQFPGVTL
QYSLDGQTWLDYDAKQAPKVSGEVWIRSVSASGERTSRVTSLK
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagaagagtcttatctcgatcgcggtattcacttcattaagtggctgcgcactc
aacactacgtcaccacaagaggtggtagacacattagcgaataacttggatgtgcaatac
caagtggtcaacaatcacggcgcggatactggtttggcttgtcaaactctagaagctgag
tgggcttcttgtaaccaagtgaatatgaccttggttaaccgtggtgaggcggtcaattca
aaagattgggctatttacttccacagtattcgcttgatcctcgatgtggggaatgaccag
ttcaaaattactcgcgttaccggcgacctacataaactggaacctaccgataagtttgat
ggttttgccgcaggtgaaacggtgactttgccgctgattggtgaatactggacgctgttt
gaaacggactttatgccacgcgcttttgtcaccgcaccggatgccgagccaaaagtcatt
gcggctttaaataccgaggacgtggcaagctttgtcagcggactggagggtgaaaacctt
aagcgcactccgagtgacaacaatgtattcgctcaagcgctgtctcgctttgaaaagaac
agtgatgttgcgctgcaagatgtgacacacgcactcatcccaacgccactgcaagtgaaa
tcgcatagcggatctgtctctatcgctaaaggtatcgcgctgccaagcaaagcgtttgac
ggtgagcaaatgcaagcgctgaatgagcgcgcacaactgcttggcgtgaatctgaaaggg
gtgatgccggcgcaagttattatcaatcctaaatcttttaaaggtgacttggctaaatct
ggtgcgtatcgcctagcgattacggataaagccgttaaagtgactgcatttgaccaagca
ggagccttctatgcgatgcaatcgctgctgggtttagtcgatatggccgatgccactcaa
ctgccaaaggttgaaatcgtcgatgctcctcgttttgattatcgcggtgtgatggtggat
gtagcgcgtaacttccactctaagcaagcgattctggcgaccttggatcaaatggcggct
tataaaatgaataagctgcatctgcacctgactgatgacgaaggctggcgtattgaaatt
ccgggcttacctgagctgacggatatcggcgctcaacgctgttttgacccgagtgaaaca
gaatgcgtgttgccacagcttggctctggtccaaacgccgataactttggctctggttat
ttcaccaagcaagattatttagagatcctgcaatacgcgaaagcacgtcatatcgaagtg
atccctgagattgatatgccagcgcacgctcgtgcggccgtggtttcaatggaggcgcgt
taccaacgtttaatgcaagagggcaatgaggcggcggccaatgagttccgtttgctggat
ccgcaagatacctctaacgtcaccacagtgcagttctatgatcgcatgagctttatcaat
ccatgtttggactcttccaaacgctttgtggataaagtgatctctgagattgcggcaatg
catcaagcggcgggtatgcctctgacgacatggcactttggtggcgatgaagcgaaaaac
atcaagcttggcgcaggcttccaagatgtgaatacccaagagccagtaagttggaaaggc
aacttggatctgagcaagcaagataagccatttgcgcgttcgccgcagtgccaaaacttg
attgcaacaggtgcggtgagtgatttcggccatttaccaagctactttgctgagcaagtg
tctaagttggttgccgagaaagggattcctaacttccaagcatggcaagatggcttgaaa
tacagcgaaggcgaaaaagcgttcgcaaccgaaaacacacgtgtgaacttctgggatgta
ctgtactggggcggctctgcttctgcgtacgaatgggctgagaaaggctacgatgtgatc
atctctaaccctgactacgtgtacatggatatgccttacgaagctgacccgaaagagcgt
ggctactactgggcaacgcgtgcaaccgacactcgtaagatgtttggttttgcaccagaa
aacttgccacaaaacgcagaaacctcactggatcgtgatggtaatggcttcagcggtaaa
ggcgaagtgaaaggtaagcctttctatggtctgtctgcgcagctgtggtctgaaaccgta
cgtactgatgagcagtatgaatacatggtattccctcgcgttctcgccgctgctgagcgc
gcatggcaccgtgcagagtgggaaaacgcctataaagttggcgtcgaatattcgcaagag
actcagttggttaaccataaagcgctgaacgcagattggaatcgctttgctaacgtatta
ggtcaacgtgagctggctaaacttgagaaagcaggcattgattaccgcctcccagttccg
ggagccaagatcgagaacggtcatttggccatgaacgttcagttcccaggtgtcacactg
caatactcactggatggtcaaacttggttggattatgacgcgaagcaagcgccaaaagtg
agcggagaagtttggattcgctcggtgtctgccagcggtgagcgcactagccgagtcact
tcactgaaataa

DBGET integrated database retrieval system