KEGG   Vibrio cholerae O395: VC395_2435Help
Entry
VC395_2435        CDS       T02099                                 

Gene name
recD
Definition
exodeoxyribonuclease V, 67 kDa subunit (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
vcr  Vibrio cholerae O395
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:vcr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2551280..2553400)
Genome map
AA seq 706 aa AA seqDB search
MMFWDSEVAKRLLAQGALRPLDVQFARFIGKQAALAGHNAAESELLSVLSAALSAELGRG
HICLPLWDAQGNRCDLAALIGLYGEASLQHSERWLALDWQALLQASPLVGKQGEAVPLMF
DGARLYLHRYWHYEKQLAARLTELAAPQRLSPAELANLRERLNTLFARDYLGLWQALQQK
PLSSVERIQLLNDRLDVVESDALDWPAIEAVVEKAQRAADLQALEQLIPLTHCLNWQKVA
AAVALTRRFAVISGGPGTGKTTTVTKLLAALISQSMAQGKVPEIKLIAPTGKAAARLTES
MGKAVSQLAIEPEIAAAIPSTSSTIHRLLGAIPGSAEFRHHARNPLHLDLLVVDEASMVD
LPLMVKLVEALPKHARLILLGDKDQLASVEAGAVLGDICTFLNQGYGNEQGAQLAELTGF
ASLRQTASKTVNPVADCLCMLQKSYRFDARSGIGQLAKAINSGSPARVETVWQQSFSDIE
HFALSGEHYQQLLQTLVQAYRPYLNLLNQSTEQFESTKQTMLTLAKSALDAFSRCRLLCA
LREGDFGVMGLNTRIERALNAHKLIKTQEEIWYHGRPIMVTRNDHGLGLYNGDIGLCMRD
RDDDQGRLKVYFELPDGSIKAVLPSRVPQHETAYAMTIHKSQGSEFDLTLLILPPDYSPI
LTRELVYTGITRAKKQLKLYCDNKVLQRAIKVKTQRASGLVARLEQ
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgatgttttgggatagtgaagtagcgaaacgtctgctggcacaaggcgcgctgcgtcct
ttggatgtgcagtttgcccgctttattggcaagcaagccgcattggcagggcacaacgct
gcagaaagtgaactgttgagtgtgctgagcgcggcgctcagtgcagaacttgggcgtgga
cacatctgtttgccactgtgggatgcacagggtaatcgctgcgatctggcggcgctgatt
ggtctttatggtgaagcgagtttgcagcacagtgaacgctggttagcgttagactggcaa
gccttactgcaagcctcgccgttggtggggaagcaaggtgaagcggtgccgttaatgttt
gatggcgcaaggctctatctgcatcgctactggcattatgaaaagcaactggcagcgcga
ttgactgagttggccgcaccccaacgtttaagccctgctgaactggctaacttgcgtgaa
cgcctgaataccttatttgcccgcgactatttaggcttgtggcaagcactacaacaaaag
ccgctgagttcggtcgagcggattcaactgctgaatgatcgattggatgtggtggagtcg
gatgcgctggattggccagcgattgaagctgtagtcgaaaaagcgcagcgtgccgcggat
ttgcaagctttagagcagcttattccgcttactcactgcttaaactggcaaaaagtggcg
gctgccgtcgcgctcacgcgccgttttgcggtgatttccggtgggccgggaaccggcaaa
accaccacagtgaccaagcttctggcggcgctgattagccaaagcatggcgcaaggtaaa
gtgccagagatcaaattgattgctccaaccggtaaagccgcggcacgcttaaccgaatcg
atgggtaaagcggtgagtcagctggcgatagagcctgagatcgccgcggcgatcccaagc
acttccagtaccattcaccgtttgcttggcgcgattccgggcagcgctgagtttcgtcat
catgcacgtaatccactccatcttgatctgttggtggtggatgaagcgtccatggtcgat
ctgcctttgatggtgaaactggtcgaagcgctgcccaagcacgctcggttgattttactt
ggcgataaagatcagttggcctcggtagaagcgggggcggtgctcggtgatatttgtacc
ttcctgaaccaaggttacggtaatgagcagggcgcgcagttggctgaactgacggggttt
gcctctttgcgccaaactgccagtaagacggtgaatccggtggcggattgcttatgcatg
ctgcaaaaaagctaccgttttgatgcacgttctggcattggccaactggcgaaagcgatc
aacagtggatctccggcgcgcgttgaaactgtgtggcagcaatcgttcagcgatattgaa
cattttgcccttagtggcgagcattatcagcaactgctgcaaaccttagtgcaggcttat
cgtccttatctgaatttgctcaatcaatcgactgagcagtttgagtcgacaaagcaaacc
atgctcacactagccaaatcagcactcgatgcgtttagtcgctgccgattattgtgcgcg
ttacgtgaaggcgattttggggtgatggggctgaacactcgcatcgaacgggcgttgaat
gcgcacaagctgattaaaactcaagaagagatctggtatcacgggcgaccgatcatggtc
acgcgtaacgatcatggcttggggctatacaatggtgatatcggtttgtgtatgcgcgat
cgtgacgatgatcagggcagactgaaagtctattttgagctgccggatggcagcattaaa
gccgtgttaccgagccgagtcccgcaacatgaaaccgcgtatgcgatgaccatacataaa
tcgcaaggcagcgaatttgatttaactttgctgattttaccgccggattacagtccgatt
ctgacgcgtgagttagtttacacggggatcacaagggcgaaaaaacagctcaaattgtat
tgcgataacaaggtattgcagcgggcaattaaagtgaaaacccaacgggcgagtggctta
gtggcaaggttggagcagtaa

DBGET integrated database retrieval system