KEGG   Vibrio cholerae O395: VC395_2533Help
Entry
VC395_2533        CDS       T02099                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
vcr  Vibrio cholerae O395
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2677264..2678016)
Genome map
AA seq 250 aa AA seqDB search
MSVLRRLTWLAFPLLSMAFNVQANTAPAQLNKAELEQRFAKLGLQVEEIKTSDINGLLEV
QTSGGVLFSSPDGEHFIAGTLYALDGNGGYVDVLAKRQAPLNAKKIAALQDSMIEFKAPN
EKYAITVFTDITCGYCVRLHSQIKEYNDLGITVRYLAYPRQGPQGQVADQMAAIWCSNDP
KAAMHDAKVNRKTITADKDIAQCQKTIAQHYMLGHELGISGTPAIFLPNGEMVGGYLPAP
QLLQRLQATQ
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtactgcgccgactaacatggctggcatttcctttactgagtatggcattcaac
gtacaagcgaacactgcaccagcacaattgaataaagccgagcttgagcagcgctttgcc
aaactcggattgcaagtggaagagataaaaacctctgatatcaatggcttgcttgaagtg
caaacgtctggtggtgtgttgttctcttcgcctgatggtgagcactttatcgcgggtact
ctgtatgcgctggatggtaatggcggttatgttgatgtgctggctaaacgccaagcgcca
ctcaacgccaagaaaattgccgcattgcaagacagcatgattgagtttaaagcgcccaat
gagaaatacgcgatcaccgtatttaccgatatcacgtgtggttactgtgtgcgtctgcac
agccagatcaaagagtacaatgatctcggcattacggtgcgttatctcgcctacccgcgt
caggggccgcaaggtcaagtcgcggatcaaatggcggccatctggtgttctaacgatccg
aaagcggcgatgcacgatgcgaaagtgaatcgtaaaaccattaccgccgataaagatatc
gcccaatgccaaaagaccatcgcgcagcactatatgctgggtcacgagctcggcattagc
ggtactccagcgattttcttacccaatggtgagatggttggcggctatttgcctgcgccg
caattgctgcaacgcctgcaagccacacaatag

DBGET integrated database retrieval system