KEGG   Vibrio cholerae O395: VC395_2624Help
Entry
VC395_2624        CDS       T02099                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase, catalytic subunit
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
vcr  Vibrio cholerae O395
Pathway
vcr00240  Pyrimidine metabolism
vcr00250  Alanine, aspartate and glutamate metabolism
vcr01100  Metabolic pathways
Module
vcr_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:vcr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    VC395_2624 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VC395_2624 (pyrB)
Enzymes [BR:vcr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     VC395_2624 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace BRCT
Motif
Other DBs
NCBI-ProteinID: ACP10610
UniProt: A5F5C9
Position
I:2784124..2785116
Genome map
AA seq 330 aa AA seqDB search
MLKPPLWGAFLWLLENIGKTIMANSLYQKHIISIAELSRAELELIVKTAGQLKAQPNPEL
IKHKVVASCFFEPSTRTRLSFETAIQRIGGSVIGFDNGGNTSLAKKGETLADSVRVISSY
VDAFVMRHPQEGAARLASEFSNGIPVINAGDGSNQHPSQTLLDLYSIFETQGRLDNLDVA
FVGDLKYGRTVHSLAQALAKFDNNRFYFVAPEALAMPDYICEELDEAGVKYQVFSDMESV
IPELDILYMTRVQKERFDESEYAHIKSAYILTAAHLSDARSNLKVLHPLPRVDEITTDVD
KTPHAYYFEQVENGVYAREALLALVLNESL
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
ttgttaaagcctcccttatggggggcttttttatggctgttagaaaatatagggaagacg
atcatggcgaattcgctttaccaaaagcacatcatctccattgctgaactctcacgcgct
gagttggagttgattgtgaaaaccgcaggccaactgaaggcacaaccgaatccagagctg
atcaagcacaaggtcgtggccagctgtttctttgaaccttccacccgtactcgcctctca
ttcgagacagcaatccaacgtatcggtggcagcgtgattggctttgataacggcggcaac
acgtcactggcgaagaaaggcgaaaccctagccgattcagtacgcgtcatctcctcttat
gttgatgcttttgtgatgcgtcatccgcaagaaggtgccgcgcgtttagcgtctgaattc
tctaacggcatccctgtgattaatgctggggacggttcaaaccaacacccatcgcaaacc
ctgctcgatctttattcgatttttgaaactcaaggccgtctcgacaacctcgatgttgcg
ttcgttggtgatttaaaatatggccgcaccgtgcattcgctggcacaagcgctggctaaa
tttgataacaaccgcttctactttgtggcaccggaagccctagcgatgccagattatatc
tgtgaagagctggatgaagctggtgtgaaataccaagtgttcagcgatatggaaagcgtg
atcccagagctggatattctgtacatgacgcgagtacagaaagagcgtttcgatgagtca
gaatacgcccacatcaagtcggcctatattttaacggcagctcacctgagtgatgcgcgt
agcaacctgaaagtgctgcacccactaccacgggtggatgagatcaccactgatgtagat
aaaaccccacacgcttactatttcgagcaagttgaaaacggcgtttatgcccgtgaagcc
ttgctggctctagttttgaacgaatcgctgtaa

DBGET integrated database retrieval system