KEGG   Vibrio cholerae O395: VC395_2783Help
Entry
VC395_2783        CDS       T02099                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vcr  Vibrio cholerae O395
Pathway
vcr00010  Glycolysis / Gluconeogenesis
vcr00051  Fructose and mannose metabolism
vcr00562  Inositol phosphate metabolism
vcr01100  Metabolic pathways
vcr01110  Biosynthesis of secondary metabolites
vcr01120  Microbial metabolism in diverse environments
vcr01130  Biosynthesis of antibiotics
vcr01200  Carbon metabolism
vcr01230  Biosynthesis of amino acids
Module
vcr_M00002  Glycolysis, core module involving three-carbon compounds
vcr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vcr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VC395_2783 (tpiA)
   00051 Fructose and mannose metabolism
    VC395_2783 (tpiA)
   00562 Inositol phosphate metabolism
    VC395_2783 (tpiA)
Enzymes [BR:vcr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     VC395_2783 (tpiA)
Exosome [BR:vcr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   VC395_2783 (tpiA)
  Exosomal proteins of bladder cancer cells
   VC395_2783 (tpiA)
  Exosomal proteins of melanoma cells
   VC395_2783 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Ntox27
Motif
Other DBs
NCBI-ProteinID: ACP10768
Position
I:2922522..2923319
Genome map
AA seq 265 aa AA seqDB search
MIRYGDIPMRRPVVMGNWKLNGSKAMVTDLLNGLNAELEGVEGVDVVVAPPAMYLDLAER
LIKEGGNKLILGAQNTDTHNSGAYTGDMSPAMLKDFGASHIIIGHSERRDYHKESDEFVA
KKFAFLKENGLTPVFCIGETEAQNEAGETEAVCARQINAVIDAYGVEALNGAIIAYEPIW
AIGTGKAATADDAQRIHASIRALIAAKDAAVAEQVIIQYGGSVKPENAASYFAQPDIDGA
LVGGASLDAKGFAAIAKAAAEAKKA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
ttgattagatatggagatattcctatgcgtcgtcctgttgtgatgggtaactggaaactg
aatggcagcaaagctatggtcactgacctgctaaacggtttgaatgcagaacttgaaggt
gttgaaggtgttgatgttgtcgttgcgccaccagcaatgtatttggatctggctgagcgc
ctgatcaaagaaggcggcaacaagctgatcctgggtgcacaaaacaccgatactcacaac
agtggtgcgtacacaggtgatatgtctcctgcgatgctgaaagatttcggtgcttcgcac
atcatcatcggtcactctgagcgtcgtgattaccacaaagaatcagatgagttcgtcgct
aagaaatttgcgttcctgaaagaaaacggcctaacgccagtcttctgtatcggtgaaact
gaagcgcaaaacgaagcgggcgaaacagaagcggtatgtgctcgccaaatcaacgcagtg
atcgatgcttacggcgttgaagcactgaacggcgcgatcatcgcttacgaaccaatctgg
gcaatcggtacgggtaaagccgcgacagcagatgatgcacagcgtatccacgcgtcaatc
cgtgcactgatcgctgcgaaagatgctgcagtggctgagcaagtgatcatccagtacggc
ggttccgtaaaaccagaaaacgcagcgtcttactttgcacaaccagacatcgatggtgcg
ctggttggcggtgcatcactggatgcgaaaggctttgccgcgatcgccaaagccgcagca
gaagcgaaaaaagcgtaa

DBGET integrated database retrieval system