KEGG   Vibrio cholerae O395: VC395_2802Help
Entry
VC395_2802        CDS       T02099                                 

Gene name
pfkA
Definition
6-phosphofructokinase, isozyme I (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vcr  Vibrio cholerae O395
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:vcr01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:vcr01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:vcr00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:vcr00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:vcr00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:vcr00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:vcr00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2942076..2943071)
Genome map
AA seq 331 aa AA seqDB search
MIFDSQSSRVSMIKKIGVLTSGGDAPGMNAAIRGVVRTALGAGLEVFGIYDGYQGLYEDR
IKQLDRSSVSDVINRGGTFLGSARFPQFREVEVREKAIENLKKHGIEALVVIGGDGSYMG
AKKLTEMGFPCIGLPGTIDNDIAGTDYTIGYLTALNTVIEAIDRLRDTSSSHQRISIVEI
MGRHCGDLTLTSAIAGGCEYIITPETGLNMEQLISNIKDGIAKGKKHAIIALTELMMDAN
KLAKEIESATGRETRATVLGHIQRGGKPTAFDRVLASRMGNYAVHLLMEGHGGRCVGIQK
EQLVHHDIIDAIENMKRPVRTDLYKVAEELF
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
ttgatattcgattcgcaaagttcgagggtgagcatgattaaaaaaatcggtgttttgacg
agtggtggcgatgccccaggtatgaatgcagctattcgcggcgtggtgcgtacagcactt
ggcgcaggtttagaagtgtttggtatttacgacggctaccaaggtctgtacgaagatcgt
attaagcagctagaccgttcaagcgtgtctgacgtgatcaaccgtggcggtactttttta
ggctctgcacgcttcccacaatttcgtgaagttgaagtgcgcgaaaaagcgattgaaaac
ctgaaaaagcacggcattgaagcgctggttgtgattggtggtgacggctcttacatgggc
gccaaaaaactgaccgaaatgggtttcccttgtatcggtctgccaggcacgattgataac
gatatcgcgggcaccgactacaccatcggttatttgactgccctgaacaccgttattgaa
gcgattgaccgtctgcgcgatacctcttcttcacaccaacgtatctctatcgtagaaatc
atgggtcgtcactgtggtgacttgacgctgacctctgcgattgcgggtggctgtgaatac
atcatcacaccggaaacgggtctgaatatggagcagctgatttccaatatcaaagatggt
attgcgaaaggcaaaaagcacgcgatcattgcgctgactgagctgatgatggatgccaac
aaactggccaaagagattgaatcggcgacaggccgtgaaactcgcgcaactgtattaggc
catattcaacgtggtggtaaacctaccgcatttgaccgtgtactggcatcgcgcatgggt
aactacgcggtgcatctattgatggaaggtcacggtggtcgttgtgtgggtatccagaaa
gagcaactggttcaccacgacatcattgatgcgattgaaaacatgaagcgtcctgtacgc
actgacctgtacaaagtcgctgaagagctgttctaa

DBGET integrated database retrieval system