KEGG   Vibrio cholerae O395: VC395_2802Help
Entry
VC395_2802        CDS       T02099                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase, isozyme I
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vcr  Vibrio cholerae O395
Pathway
vcr00010  Glycolysis / Gluconeogenesis
vcr00030  Pentose phosphate pathway
vcr00051  Fructose and mannose metabolism
vcr00052  Galactose metabolism
vcr00680  Methane metabolism
vcr01100  Metabolic pathways
vcr01110  Biosynthesis of secondary metabolites
vcr01120  Microbial metabolism in diverse environments
vcr01130  Biosynthesis of antibiotics
vcr01200  Carbon metabolism
vcr01230  Biosynthesis of amino acids
vcr03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:vcr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VC395_2802 (pfkA)
   00030 Pentose phosphate pathway
    VC395_2802 (pfkA)
   00051 Fructose and mannose metabolism
    VC395_2802 (pfkA)
   00052 Galactose metabolism
    VC395_2802 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    VC395_2802 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    VC395_2802 (pfkA)
Enzymes [BR:vcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     VC395_2802 (pfkA)
Protein phosphatases and associated proteins [BR:vcr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     VC395_2802 (pfkA)
Messenger RNA biogenesis [BR:vcr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     VC395_2802 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ACP10787
Position
I:complement(2942076..2943071)
Genome map
AA seq 331 aa AA seqDB search
MIFDSQSSRVSMIKKIGVLTSGGDAPGMNAAIRGVVRTALGAGLEVFGIYDGYQGLYEDR
IKQLDRSSVSDVINRGGTFLGSARFPQFREVEVREKAIENLKKHGIEALVVIGGDGSYMG
AKKLTEMGFPCIGLPGTIDNDIAGTDYTIGYLTALNTVIEAIDRLRDTSSSHQRISIVEI
MGRHCGDLTLTSAIAGGCEYIITPETGLNMEQLISNIKDGIAKGKKHAIIALTELMMDAN
KLAKEIESATGRETRATVLGHIQRGGKPTAFDRVLASRMGNYAVHLLMEGHGGRCVGIQK
EQLVHHDIIDAIENMKRPVRTDLYKVAEELF
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
ttgatattcgattcgcaaagttcgagggtgagcatgattaaaaaaatcggtgttttgacg
agtggtggcgatgccccaggtatgaatgcagctattcgcggcgtggtgcgtacagcactt
ggcgcaggtttagaagtgtttggtatttacgacggctaccaaggtctgtacgaagatcgt
attaagcagctagaccgttcaagcgtgtctgacgtgatcaaccgtggcggtactttttta
ggctctgcacgcttcccacaatttcgtgaagttgaagtgcgcgaaaaagcgattgaaaac
ctgaaaaagcacggcattgaagcgctggttgtgattggtggtgacggctcttacatgggc
gccaaaaaactgaccgaaatgggtttcccttgtatcggtctgccaggcacgattgataac
gatatcgcgggcaccgactacaccatcggttatttgactgccctgaacaccgttattgaa
gcgattgaccgtctgcgcgatacctcttcttcacaccaacgtatctctatcgtagaaatc
atgggtcgtcactgtggtgacttgacgctgacctctgcgattgcgggtggctgtgaatac
atcatcacaccggaaacgggtctgaatatggagcagctgatttccaatatcaaagatggt
attgcgaaaggcaaaaagcacgcgatcattgcgctgactgagctgatgatggatgccaac
aaactggccaaagagattgaatcggcgacaggccgtgaaactcgcgcaactgtattaggc
catattcaacgtggtggtaaacctaccgcatttgaccgtgtactggcatcgcgcatgggt
aactacgcggtgcatctattgatggaaggtcacggtggtcgttgtgtgggtatccagaaa
gagcaactggttcaccacgacatcattgatgcgattgaaaacatgaagcgtcctgtacgc
actgacctgtacaaagtcgctgaagagctgttctaa

DBGET integrated database retrieval system