KEGG   Vibrio cholerae O395: VC395_A0013Help
Entry
VC395_A0013       CDS       T02099                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
vcr  Vibrio cholerae O395
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:vcr00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:17245..19386
Genome map
AA seq 713 aa AA seqDB search
MARAAFADPFSFLGPYIPAEQGALRVWMPGADNVALVVEGQARVALEREGEGGFVLKDGR
NLRFTHYQLAVDWAGTEQLLDDPYQYHGLYAEYEDLHTPKQMYHHMGAQFVTLERDGKMV
SGVRFLVYAPHAAACSLIGAFNHWDGRRHPMQRLDYGIWGIFIPGLPEGTQYKFELKGPH
GEGLPHKADPWGFYAEQYPSFASVTYDHRRYQWQDTAWQQRPVTEKRKQALSFYELHVGS
WKRGENGEFLNYRELADQLVPYLVEMGYTHVELMPVAEHPFYGSWGYQPVGLFAPTSRYG
SPDDFKYFVDLCHQAGIGVVLDWVPAHFPSDSHGLANFDGTPLFHDPDPRRGWHQDWNSY
IYDLGREHVRRFLVANALYWFEMFHIDGIRVDAVASMLYLDYSRSHDQWIPNVDGGRENY
DAIATFKWMNEEVYKHFPNAMTIAEESTAFPGVSAPTFMGGLGFGFKWNMGWMHDSLSYI
KEDPVHRKYHHNTLTFPLIYAFSENYVLSLSHDEVVYGKRSLMYKMPGDEWQQTANLRAY
LGYMYGQPGKKLNFMGTELGQTAEWDHDGQLQWFLTQFERHAGIQRLVRDLNHLYQAQTA
LHQLDCDPRCFEWRLQDNADLSVIAHERMDEAGNRVLVITNFTPVPQQAFRLGVPKTGKY
RLLLNTDAKQYNGSDYPVLQDVSTEAISSEGLDQSLLLSVPPLATLFYQWSAK
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
ttggcgcgtgcagcgtttgctgatcccttttcatttctaggcccttacattcccgctgaa
caaggtgcgctgcgagtgtggatgccgggggctgacaacgtcgcgttggtggttgaaggg
caagctcgtgtggcgttagagcgtgaaggcgagggcggctttgtgctgaaagatggccgt
aatctgcgttttacgcactaccaattggctgtcgattgggcgggtaccgagcagttactc
gatgatccgtatcaatatcacggcctctacgctgaatatgaagatctgcatacgccaaag
cagatgtatcaccatatgggggcgcagtttgtcaccctagagcgtgatggaaaaatggtc
tctggcgtacgttttctggtgtatgcccctcacgcggcggcgtgcagtttgattggcgcg
tttaaccattgggatggtcgtcgccatccgatgcagcgtctcgattacggtatttgggga
atttttatccccggcttgccggaaggcacgcaatacaaatttgagctgaaaggcccacat
ggagaaggtctgccgcataaagcggatccgtggggtttttatgctgagcaatacccttct
tttgcttctgtgacttatgatcaccgtcgttatcagtggcaagatacggcttggcagcag
cgccctgtgactgaaaagcgtaaacaagcgctctcgttttatgagctgcacgttggctca
tggaagcgaggcgaaaacggtgaattcctcaattatcgtgaattggccgatcaattggtg
ccttatctggttgagatgggttatacccatgttgagttaatgcctgtcgctgagcaccca
ttttatggttcttggggctatcaaccggttggtctgtttgcgcccactagccgttacggc
tcgccggatgatttcaaatattttgtcgatttgtgccaccaagcggggattggtgtggtg
ctcgattgggtgcctgcgcacttcccgtcggattctcacggtctggccaattttgatggc
acgcccttattccatgatccggatccacgtcgcggttggcatcaagactggaactcttac
atctacgatcttggtcgcgagcatgtgcgccgtttcttagtcgctaatgcgctgtattgg
tttgagatgttccatatcgatggcattcgcgttgatgcggtcgcatcgatgctctatctc
gattattcgcgtagccatgatcaatggatcccgaatgttgacggtggacgcgaaaactac
gatgcgattgctaccttcaaatggatgaacgaggaggtgtacaaacacttcccgaatgcg
atgacgattgccgaagagtcgactgcgtttcctggcgtttctgccccgacctttatgggc
ggtctcgggtttggttttaagtggaacatgggctggatgcacgatagcttatcgtacatc
aaagaggatccggtgcatcgtaaataccaccacaataccctgactttcccgctgatttac
gcgtttagtgaaaactatgtgctctctttatcacacgatgaagtggtgtatggtaagcgc
tcgcttatgtacaagatgccgggtgatgagtggcagcaaaccgccaacttacgcgcctac
ttgggttatatgtatggtcagccgggcaaaaaactcaactttatgggtaccgaattagga
cagactgcggagtgggatcacgatggtcagttgcagtggttcttaacgcaatttgagcgc
catgcggggatccagcgtttggtgcgtgatttgaaccatctgtaccaagcccaaaccgcg
ttgcatcagcttgattgcgatccgcgttgcttcgaatggcgcttacaagataatgccgat
ctcagcgtgatcgcccatgaacggatggatgaagctggtaatcgtgtgttagtgatcacc
aacttcacgcctgttccacagcaggcatttcgcttaggtgttcctaaaacagggaagtac
cgcttgttgctcaatactgatgccaagcagtacaacggcagtgattatccggtattgcag
gatgtgagtacggaagcgatcagcagtgaaggtttggatcaatcgctgctattgagtgtg
ccgccgctcgcgacgctattttatcaatggagtgcgaagtag

DBGET integrated database retrieval system