KEGG   Vibrio cholerae O395: VC395_A0569Help
Entry
VC395_A0569       CDS       T02099                                 

Gene name
gplK
Definition
glycerol kinase (EC:2.7.1.3)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
vcr  Vibrio cholerae O395
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:vcr00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:515964..517481
Genome map
AA seq 505 aa AA seqDB search
MTEQKYVVALDQGTTSSRAVVLDHDANIVSVSQREFTQIYPQAGWVEHDPMEIYATQSST
LVEALGKAGIRSDEVAAIGITNQRETTVVWNKETGKPVYNAIVWQCRRTATICEELKARG
LESYIRDNTGLVLDPYFSGTKIKWILDNVEGAREQAEAGQLLFGTVDTWLVWKMTQGRVH
VTDYTNASRTMLFNINTLQWDEKILAEFNIPLSMMPEVKKSSEVYGQTNIGGKGGTRIPI
AGIAGDQQAALYGQMCVQAGQAKNTYGTGCFLLMNTGQEKVTSHNGLLTTLACGPRGEPA
YALEGAVFMGGASIQWLRDELKLISDARDSEYFATKVDTSNGVYVVPAFTGLGAPYWDAY
ARGTIVGLTRGVNSNHIIRATLESIAYQTRDVLDAMQADSGIKLSALRVDGGAVANNFLM
QFQADVLDTEVHRPKVTEVTALGAAYLAGLAVGFWDGLEELQGKAEIDRSFKPHHDEEKR
QRRYKGWKRAVKCAQAWAVLHNEEE
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcaaaaatacgtcgtcgctctcgatcaaggtactaccagctctcgcgccgtg
gtgttagaccatgatgcgaatatcgtgagcgtttctcagcgtgagtttacccaaatctac
ccgcaagccgggtgggtggagcacgatccaatggaaatctacgctacgcaaagctcaaca
ttggttgaagcgctaggtaaagcgggcattcgcagtgatgaagttgcggctatcggtatt
accaaccaacgtgaaaccacggtagtgtggaataaagagacgggtaagcctgtctacaac
gcgattgtttggcaatgtcgccgtactgctaccatttgtgaagagctgaaagcgcgcggt
ttagaaagttacattcgcgacaataccggtttggtgctcgacccttacttctcaggtacc
aaaattaaatggattctggacaatgtagaaggcgcacgcgagcaagctgaagcaggacaa
ctgctgtttggtacggttgatacgtggctagtgtggaaaatgactcaaggccgtgtgcat
gtgaccgattacaccaacgcatcccgtactatgctgttcaacatcaacaccttgcagtgg
gatgaaaagatcctcgccgaatttaatatcccgctctccatgatgccggaagtgaaaaaa
tcgtctgaagtgtacggtcaaaccaacatcggtggtaaaggcggtacgcgtattccaatc
gcggggattgccggtgaccaacaagcggcgctgtacggccaaatgtgtgtgcaagcggga
caagcgaaaaacacctacggtacgggttgcttcttgctgatgaacacaggacaggaaaaa
gtgacctcgcacaacggcttgctgaccacgctagcgtgtggcccacgtggtgaacccgct
tatgcactggaaggtgcggtgtttatgggcggtgcatcgattcaatggctgcgtgatgaa
ctgaaactgatttccgatgctcgcgactcagaatacttcgccaccaaagtggatacttca
aatggtgtgtatgtggtgccagcctttacgggtttaggcgctccgtactgggatgcgtat
gcgcgtggcacaattgtcggcttaacccgtggtgtgaattcaaaccacattattcgcgca
acgctggaaagtatcgcttaccaaacgcgtgatgtgctggatgcgatgcaagcggattcg
ggcatcaagctttctgcactgcgtgtcgatggcggtgcggtcgccaacaacttcctgatg
cagttccaagcggatgtattggatactgaagtgcatcgtccgaaagtcacggaagtcacc
gcgttaggtgccgcttatctagccggtcttgctgttggtttctgggatggtttggaagag
ctgcaaggcaaagcggaaatcgatcgcagctttaaaccgcatcatgatgaagagaagcgt
caacgccgttataaaggttggaagcgtgcggtgaaatgtgcccaagcgtgggcagtactg
cacaacgaagaagagtaa

DBGET integrated database retrieval system