KEGG   Vibrio cholerae O395: VC395_A0622Help
Entry
VC395_A0622       CDS       T02099                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vcr  Vibrio cholerae O395
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:vcr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VC395_A0622
   00630 Glyoxylate and dicarboxylate metabolism
    VC395_A0622
   00640 Propanoate metabolism
    VC395_A0622
   00650 Butanoate metabolism
    VC395_A0622
  Lipid metabolism
   00071 Fatty acid degradation
    VC395_A0622
   00072 Synthesis and degradation of ketone bodies
    VC395_A0622
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VC395_A0622
   00310 Lysine degradation
    VC395_A0622
   00380 Tryptophan metabolism
    VC395_A0622
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VC395_A0622
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VC395_A0622
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    VC395_A0622
Enzymes [BR:vcr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     VC395_A0622
Exosome [BR:vcr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VC395_A0622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
II:574125..575330
Genome map
AA seq 401 aa AA seqDB search
MEKIYIVGAKRSAIGAFGGSLKECSAGALAGQVIQAALEAAQVKPEAVDEVIVGNVVSAG
QGMGVGRQAALVAGVPQSVPAYSINMVCGSGMKSVMDGVAHIKAGDASVVVAAGVEVMSQ
IPFVTPASLRDGQKMGAFEVKDLLIHDGLTDVFNQYHMGVTAENIAKQYDIARQTQDEFA
LASQMKATAAIEAGHFKREIVPISVKKRRETVVFDTDEYPKPTTTLAALQGLRAAFDAQG
TVTAGNASGINDGASAVIIASESAVKKLGLTPIAEIMSYAQTGLDPKVMGLGPVSAVTQA
LAKAELSITQVDLFELNEAFAAQALGVVYGLADQHAIQPEAILEKANVNGGAIALGHPLG
ASGNRILVTLLHELQRRQKHYGVASLCVGGGMGTAIVIKTV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagatctatatcgtgggagcaaagcgctcagctatcggagcctttggtggttca
cttaaagagtgttcggcaggcgctttggcaggacaagtcatccaagccgctcttgaagcc
gcacaagtcaaacctgaagctgtcgatgaagtgattgttggtaacgttgtgagtgccgga
caaggcatgggtgttgggcgtcaagcggctttagtggctggtgttccacagtcggttcca
gcttacagcatcaacatggtgtgtggcagtgggatgaaatcggtgatggatggggttgcg
cacatcaaagcgggagatgcttctgtcgttgtggccgctggtgttgaggtcatgtcacaa
atcccatttgttacgcctgccagcttacgagatgggcagaaaatgggcgcgtttgaagtg
aaagatctgctcatccatgacggtctgaccgatgtcttcaatcaataccacatgggtgtg
acggcagaaaatatcgctaaacagtacgacatcgctcgtcaaacacaagatgagtttgcg
ttggccagccaaatgaaagcgacagcggccattgaagccggacattttaagcgagaaatt
gtgcctatttcggtcaaaaaacgccgtgaaaccgtcgtgtttgatacggatgaataccct
aaaccgacgaccacgttggcagcattgcaaggcttacgcgccgccttcgatgcacaaggt
acggttaccgcaggtaatgcttctggaattaacgatggtgccagtgcggtgattatcgcc
agcgaaagtgcggtaaaaaaactaggcttaacccctatcgcagaaattatgagttatgca
caaacagggttggatccgaaagtcatgggcttagggcctgtgagtgcagtcactcaagca
ttagcgaaagcagaattatctatcactcaggttgatctgtttgaacttaacgaagcgttt
gccgctcaagcattaggtgtcgtttacggtttagctgatcaacacgcgattcaacctgag
gcgattttagaaaaagccaacgtcaatggcggtgccattgcgttagggcatccactaggg
gcatcgggtaaccgcattctggttactctgcttcatgaattacagcgtcgccaaaaacat
tatggcgtcgcttcactctgcgtcggcggtggcatgggcaccgcgatcgtgattaaaaca
gtttaa

DBGET integrated database retrieval system