KEGG   Vibrio cholerae O395: VC395_A0699Help
Entry
VC395_A0699       CDS       T02099                                 

Gene name
folE
Definition
GTP cyclohydrolase (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
vcr  Vibrio cholerae O395
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:vcr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:651268..651960
Genome map
AA seq 230 aa AA seqDB search
MSAIRKGYLRGRGMSGLSESAKLVKDALERRGLETPMQPNLATPAEKKEKIEQHMREILN
LLGLDLTDDSLEETPQRIAKMYVDEIFSGLDYANFPKITVIENKMKVSEMVKVKDITLTS
TCEHHLVTIDGTAAVAYIPRGKIIGLSKINRIVRFFAQRPQVQERMTQQILVALQTLLES
DDVAVTIDATHYCVKSRGVMDATSVTTTTALGGIFKSNPATRAEFLHGLR
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
ttgtcagccatccgaaaggggtatttaagaggtagaggaatgtcaggtcttagcgaatcc
gcgaagttggtgaaagatgcgctagagcgccgagggttggaaacaccaatgcagcccaac
ttggcgacaccagcagagaaaaaggaaaaaatcgaacagcatatgcgtgagatcctcaac
ctgctcggactggacttaacggatgacagtttggaagaaaccccacaacgcatcgctaag
atgtatgtggatgagatcttctcagggttggattatgccaacttccccaaaataactgtt
atcgaaaataagatgaaagtgagtgagatggttaaagtgaaagacatcacgctgaccagc
acgtgtgaacaccacttagtcaccatcgatggcacggcagcggtggcgtacatcccgcgc
ggcaaaatcatcggcttatcgaaaattaaccgtattgtgcgcttttttgcccagcgtccg
caggtgcaagagcgtatgacgcagcagatcctagttgcgctgcaaacgttgcttgagtcg
gatgatgtggcagttaccatagatgcgactcactattgcgtgaaatctcgcggcgtgatg
gatgcaaccagcgtcaccacaacaaccgctttgggggggatttttaaatctaaccctgca
acgcgtgcggaattcctacacggtttgcgttaa

DBGET integrated database retrieval system