KEGG   Vibrio cholerae O395: VC395_A0747Help
Entry
VC395_A0747       CDS       T02099                                 

Gene name
ctxA
Definition
cholera enterotoxin, A subunit (EC:2.4.2.36)
Orthology
K10928  
cholera enterotoxin subunit A [EC:2.4.2.36]
Organism
vcr  Vibrio cholerae O395
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
II:complement(696794..697570)
Genome map
AA seq 258 aa AA seqDB search
MVKIIFVFFIFLSSFSYANDDKLYRADSRPPDEIKQSGGLMPRGQSEYFDRGTQMNINLY
DHARGTQTGFVRHDDGYVSTSISLRSAHLVGQTILSGHSTYYIYVIATAPNMFNVNDVLG
AYSPHPDEQEVSALGGIPYSQIYGWYRVHFGVLDEQLHRNRGYRDRYYSNLDIAPAADGY
GLAGFPPEHRAWREEPWIHHAPPGCGNAPRSSMSNTCDEKTQSLGVKFLDEYQSKVKRQI
FSGYQSDIDTHNRIKDEL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagataatatttgtgttttttattttcttatcatcattttcatatgcaaatgat
gataagttatatcgggcagattctagacctcctgatgaaataaagcagtcaggtggtctt
atgccaagaggacagagtgagtactttgaccgaggtactcaaatgaatatcaacctttat
gatcatgcaagaggaactcagacgggatttgttaggcacgatgatggatatgtttccacc
tcaattagtttgagaagtgcccacttagtgggtcaaactatattgtctggtcattctact
tattatatatatgttatagccactgcacccaacatgtttaacgttaatgatgtattaggg
gcatacagtcctcatccagatgaacaagaagtttctgctttaggtgggattccatactcc
caaatatatggatggtatcgagttcattttggggtgcttgatgaacaattacatcgtaat
aggggctacagagatagatattacagtaacttagatattgctccagcagcagatggttat
ggattggcaggtttccctccggagcatagagcttggagggaagagccgtggattcatcat
gcaccgccgggttgtgggaatgctccaagatcatcgatgagtaatacttgcgatgaaaaa
acccaaagtctaggtgtaaaattccttgacgaataccaatctaaagttaaaagacaaata
ttttcaggctatcaatctgatattgatacacataatagaattaaggatgaattatga

DBGET integrated database retrieval system