KEGG   Vibrio cholerae O395: VC395_A0981Help
Entry
VC395_A0981       CDS       T02099                                 

Definition
(GenBank) GGDEF family protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
vcr  Vibrio cholerae O395
Brite
Enzymes [BR:vcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     VC395_A0981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
II:943730..944749
Genome map
AA seq 339 aa AA seqDB search
MMTTEDFKKSTANLKKVVPLMMKHHVAATPVNYALWYTYVDQAIPQLNAEMDSVLKNFGL
CPPASGEHLYQQYIATKAETNINQLRANVEVLLGEISSSMSDTLSDTSSFANVIDKSFKD
LERVEQDNLSIEEVMTVIRRLVSDSKDIRHSTNFLNNQLNAATLEISRLKEQLAKVQKDA
LFDSLSGLYNRRAFDGDMFTLIHAGQQVSLIMLDIDHFKALNDNYGHLFGDQIIRAIAKR
LQSLCRDGVTAYRYGGEEFALIAPHKSLRIARQFAESVRRSIEKLTVKDRRSGQSVGSIT
ASFGVVEKIEGDSLESLIGRADGLLYEAKNLGRNRVMPL
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgatgacaactgaagatttcaaaaaatccacggctaacttaaaaaaagtcgtaccttta
atgatgaaacatcatgtcgcggccacccccgtgaactatgccttgtggtatacctacgtc
gaccaagccattccgcaactgaatgcggaaatggactctgtattgaaaaattttgggctt
tgcccacccgcttctggtgaacatctttaccaacaatacattgcgaccaaagcagaaacc
aatattaatcagttacgtgcgaatgttgaggtacttcttggtgaaattagcagttcaatg
agtgatacgctcagtgacaccagttcctttgctaatgtgattgataaaagctttaaggat
ttagagcgcgtcgagcaagacaatctctcgattgaagaagtaatgacggtgatccgccgc
ttggtgagtgactctaaagatattcgacactcaaccaatttcctaaataatcaactgaac
gcggcaacactagaaatctctcgtcttaaagagcagctggcgaaagttcagaaagatgct
ctgtttgacagtttatctggactctataaccgccgagcttttgatggcgatatgttcacg
ctgatccatgcaggtcaacaagtcagcctgatcatgctcgacatcgaccacttcaaagcc
cttaatgataactatggccacctgtttggtgaccaaattatccgtgcgatcgccaaacgt
cttcaaagcctatgccgtgacggcgtgacagcttatcgttatggcggtgaagagtttgca
ctgattgctccgcacaaatcgctgcgtattgcacgccagtttgctgaatcggtgcgacgt
tcaatagaaaagctcaccgtaaaagatcggcgtagcggtcaatcggtcggtagcattacc
gcttcgtttggtgtagtagaaaagattgaaggtgactctttggagtctcttatcggtcga
gcggatggattgctgtatgaagcgaaaaatctgggccgcaatcgagtcatgccgctctaa

DBGET integrated database retrieval system