KEGG   Vibrio cholerae O395: VC395_A0982Help
Entry
VC395_A0982       CDS       T02099                                 

Definition
(GenBank) malate synthase-related protein
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
vcr  Vibrio cholerae O395
Pathway
vcr00620  Pyruvate metabolism
vcr00630  Glyoxylate and dicarboxylate metabolism
vcr01100  Metabolic pathways
vcr01110  Biosynthesis of secondary metabolites
vcr01120  Microbial metabolism in diverse environments
vcr01200  Carbon metabolism
Module
vcr_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vcr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VC395_A0982
   00630 Glyoxylate and dicarboxylate metabolism
    VC395_A0982
Enzymes [BR:vcr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VC395_A0982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACP11813
Position
II:complement(944868..945476)
Genome map
AA seq 202 aa AA seqDB search
MTLNLDEGTTMNMLTFDKTEIQHQNKPFIAEAVFAVETVAANQQREKQTKAKQLLDRLFP
LENGTHQDVTAYVIDYNHLLAYFQDGRHSGLKYPKQFVAFNGSKENPSHLLFRDGQGSHV
EMTLGCQRGTGCIELREIADIQLETCTVLNHSNDHAQPSTTIRHWVSLIKGDEQGRPQAR
IEEKEYTARNGDEYFLGDCFSH
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgacattgaatctggacgagggaacgacgatgaacatgctgacgtttgataaaacagaa
atccaacaccaaaacaaaccctttatcgctgaagctgtgttcgccgtagaaacggtcgcc
gccaatcaacagcgtgaaaaacaaaccaaagccaaacagttattggatcgtctgtttccg
cttgaaaatggtactcaccaagatgtgaccgcatacgtgatagattacaaccatctgctc
gcttactttcaagatggacgtcatagtggcttgaaatacccaaaacagtttgtggcgttt
aatggcagtaaagaaaatccaagccatcttctgtttcgtgatgggcaaggtagtcatgtt
gaaatgacattaggttgccagcgcggcacgggttgcattgagttacgagaaatcgcagac
attcaattagaaacgtgcacagtactcaatcattctaatgaccacgcacagccaagcacc
actattcgccactgggtaagtttgatcaaaggcgatgaacaaggtcgaccacaagctcgt
attgaagagaaagagtatacagctcgaaatggtgacgaatatttcctcggagactgtttt
tcacattaa

DBGET integrated database retrieval system