KEGG   Vibrio cholerae O395: VC395_A1110Help
Entry
VC395_A1110       CDS       T02099                                 

Gene name
cheB-3
Definition
protein-glutamate methylesterase CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
vcr  Vibrio cholerae O395
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:vcr02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:vcr02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1083617..1084657)
Genome map
AA seq 346 aa AA seqDB search
MKKIKVLIVDDSPVFRALLTQLIDSDPALQVVASAEDPYQARELIKHYQPDVVTLDVEMP
KMNGVQFLKNLMRLHPLPVVMISTLTQHGAEATLAALELGAVDYFPKPSSDNPAEMLNYK
NLVNDKIKMAAQANVGFVQSATVSAPITERVSTDYQLIAIGSSTGGTEAVKQVLAALPSG
LPPIVMTQHIGAQFTASLAKRLNDSSALHVQEVTQPTTALESSCAYLAPGDKHIVVVKRA
GKLYVELDDRPAVNRHKPSVDVMFNSIAQHVGSKAMGILLTGMGQDGAKGMLAMHQQGAA
TAAQDEQSSVVWGMPRVAIELGAADVVKPLGAMATWIVEQLQKKHA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcaaagtcttgatcgtggatgattctccggtatttcgggctttattaacc
cagttgattgatagcgaccccgcgttgcaagtggtggcgagcgcagaagatccttaccaa
gcgcgtgaactgattaagcactatcaacccgatgtggtgaccttagatgttgaaatgccc
aaaatgaatggtgtgcagtttcttaaaaatctgatgcgccttcatccattacctgtggtg
atgatctccaccttaacccagcacggtgcggaagcaacgttggcggctcttgagttaggc
gctgtggattatttccccaaaccttcttcagataacccggctgaaatgctcaattataaa
aacttggtgaatgacaaaatcaaaatggcggcacaagccaatgtagggtttgtgcagagt
gcgacggtttcagcgcccattacggagcgagtttccaccgattaccagttgattgctatc
ggctcttctactggtggtacggaagccgtcaaacaagtcctcgcagcattaccttctggc
ttacctcctatcgtcatgactcagcatattggcgcgcagtttacggcctccttagcgaaa
cgattaaatgacagcagcgctctccatgtacaagaggtgacacaaccaacgacagcactt
gagagtagctgcgcctatctcgctccaggcgataagcatatcgtggtcgtgaaacgggct
ggcaaactttatgttgagttagatgacagacctgcggtgaatcggcacaaaccctcggtg
gatgtaatgtttaattcaattgctcagcatgtaggcagtaaagcgatggggattttgttg
accggcatgggacaagatggcgcgaaaggcatgttggcgatgcatcaacaaggagcggcg
accgcagcgcaggatgagcaatcaagcgtggtttggggcatgccgcgagtagcgatcgag
ctgggggctgcggatgtcgtcaaacctttaggggcaatggcgacttggattgttgaacaa
ctacaaaagaagcacgcataa

DBGET integrated database retrieval system