KEGG   Vibrio cholerae MS6: MS6_A0737Help
Entry
MS6_A0737         CDS       T03666                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vcs  Vibrio cholerae MS6
Pathway
vcs00071  Fatty acid degradation
vcs00280  Valine, leucine and isoleucine degradation
vcs00310  Lysine degradation
vcs00362  Benzoate degradation
vcs00380  Tryptophan metabolism
vcs00620  Pyruvate metabolism
vcs00630  Glyoxylate and dicarboxylate metabolism
vcs00640  Propanoate metabolism
vcs00650  Butanoate metabolism
vcs00900  Terpenoid backbone biosynthesis
vcs01100  Metabolic pathways
vcs01110  Biosynthesis of secondary metabolites
vcs01120  Microbial metabolism in diverse environments
vcs01130  Biosynthesis of antibiotics
vcs01200  Carbon metabolism
vcs01212  Fatty acid metabolism
vcs02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vcs00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MS6_A0737
   00630 Glyoxylate and dicarboxylate metabolism
    MS6_A0737
   00640 Propanoate metabolism
    MS6_A0737
   00650 Butanoate metabolism
    MS6_A0737
  Lipid metabolism
   00071 Fatty acid degradation
    MS6_A0737
   00072 Synthesis and degradation of ketone bodies
    MS6_A0737
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MS6_A0737
   00310 Lysine degradation
    MS6_A0737
   00380 Tryptophan metabolism
    MS6_A0737
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MS6_A0737
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MS6_A0737
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MS6_A0737
Enzymes [BR:vcs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MS6_A0737
Exosome [BR:vcs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MS6_A0737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAP04996
Position
2:complement(639525..640730)
Genome map
AA seq 401 aa AA seqDB search
MEKIYIVGAKRSAIGAFGGSLKECSAGALAGQVIQAALEAAQLKPEAVDEVIVGNVVSAG
QGMGVGRQAALAAGVPQSVPAYSINMVCGSGMKSVMDAVAHIKAGDASVVVAAGVEVMSQ
IPFVTPASLRDGQKMGAFEVKDLLIHDGLTDVFNQYHMGVTAENIAKQYDIARQTQDEFA
LASQMKATAAIEAGHFKREIVPISVKKRRETVVFDTDEYPKPTTTLAALQGLRAAFDAQG
TVTAGNASGINDGASAVIIASESAVKKLGLTPIAEIMSYAQTGLDPKVMGLGPVSAVTQA
LAKAELSITQVDLFELNEAFAAQALGVVYGLAEQHAIQPEAILEKANVNGGAIALGHPLG
ASGNRILVTLLHELQRRQKHYGVASLCVGGGMGTAIVIKTV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagatctatatcgtgggcgcaaagcgctcagctatcggagcctttggtggttca
cttaaagagtgttcagcaggcgctttggcagggcaagtcatccaagccgctcttgaagcc
gcacaactcaaacctgaagctgtggatgaagtgattgttggtaacgttgtgagtgccgga
caaggcatgggtgttgggcgtcaagcggctttagcggctggtgttccacagtcggttcca
gcttacagcatcaacatggtgtgtggcagtgggatgaaatcggtgatggatgcggttgcg
cacatcaaagcgggagatgcttctgtcgttgttgccgctggtgttgaggtcatgtcacaa
atcccatttgttacgcctgccagcttacgagatgggcagaaaatgggcgcgtttgaagtg
aaagatctgctcatccatgacggtctgaccgatgtcttcaatcaataccacatgggtgtg
acggcagaaaatatcgctaaacagtacgacatcgctcgtcaaacacaagatgagtttgcg
ttggccagccaaatgaaagcgacagcggccattgaagccggacattttaagcgagaaatt
gtgcctatttcggtcaaaaaacgccgtgaaaccgtcgtgtttgatacggatgaataccct
aaaccgacgaccacgttggcagcattgcaaggcttacgcgccgcgttcgatgcacaaggt
acggttaccgcaggtaatgcttctggaattaacgatggtgccagtgcggtgattatcgcc
agtgaaagtgcggtaaaaaaactaggcttaacccctatcgcagaaattatgagttatgca
caaacagggttggatccgaaagtcatgggcttagggcctgtgagtgcagtcactcaagca
ttagcgaaagcagaattatctatcactcaggttgatctgtttgaacttaacgaagcgttt
gccgctcaagcattaggtgtcgtttacggtttagctgagcaacacgcgattcaacctgag
gcgattttagaaaaagccaacgtcaatggcggtgccattgcgttagggcatccattaggg
gcatcgggtaaccgcattctggttactctgcttcatgaattacagcgtcgccaaaaacat
tatggcgttgcttcactctgcgtcggcggtggcatgggtaccgcgatcgtgattaaaaca
gtttaa

DBGET integrated database retrieval system