KEGG   Verticillium dahliae: VDAG_00075Help
Entry
VDAG_00075        CDS       T03450                                 

Definition
(RefSeq) hypothetical protein
Organism
vda  Verticillium dahliae
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2
AA seq 208 aa AA seqDB search
MPRTDDTQLPLLGDTINEHPEQGLPEAALHEPQQRAQLPQLLSSRRKHMVVLILVALDVA
ALLANIFIELVECDRRNEKLQRPAWTGNARQALTTAGLVFSSLFLLELVFCIVAFGLNHH
VVDHQTGYLKDWFHCLDAVVIVTSFVVDLLSHGIVEDIASLVIVFRLFRFAKMLEEMSMG
AAERIESMANELDKLRMENTLLKERHQV
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgcctcggacagacgacacgcagctgccccttctgggcgataccatcaacgagcatccc
gaacaaggactgccagaagcagccttacacgaacctcagcagcgagcccagcttccgcag
cttctttcatcgaggaggaagcacatggttgtgcttatactcgtcgcgctggacgtggcg
gccttgctcgcgaacatcttcatcgagctggtggaatgcgaccgccgcaacgagaagctc
cagaggccggcatggacaggcaacgcgcgccaagccctcacgacggctggactggtgttc
agcagcctgttcctgctcgagttggtcttctgcatagtggctttcgggcttaaccaccat
gtggttgaccatcaaaccgggtatctcaaagactggttccactgcctcgacgcggtagtc
atcgttacgagcttcgtcgtcgacctactgtcccacggcatcgtcgaagacattgcatca
ctggtcattgtgttccgcctcttccgctttgccaagatgctcgaggagatgagcatgggc
gctgccgagcgtatagagagcatggccaatgaactcgacaaactgcgaatggagaacacc
ctgttgaaggaaaggcatcaagtgtga

DBGET integrated database retrieval system