KEGG   Verticillium dahliae: VDAG_05551Help
Entry
VDAG_05551        CDS       T03450                                 

Definition
(RefSeq) glycosyl hydrolases family 32 superfamily
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
vda  Verticillium dahliae
Pathway
vda00052  Galactose metabolism
vda00500  Starch and sucrose metabolism
vda01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vda00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    VDAG_05551
   00500 Starch and sucrose metabolism
    VDAG_05551
Enzymes [BR:vda01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     VDAG_05551
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C BNR BNR_2
Motif
Other DBs
NCBI-GeneID: 20707014
NCBI-ProteinID: XP_009650741
UniProt: G2X5P6
Position
2
AA seq 573 aa AA seqDB search
MSLVTTRTTAHEASTQARLPLKHHAPSYHLKARGWMNDPCGPGYNPITKTYHIFYQWNPY
GCEWGNMSWGHATSQDGLRWTHAPSGEPALKPSEPYDKEGIFTGCFWPTGPHGEKDQLTV
VYSSIAALPIHWTLKHIRNSEGVSLATSTDAGKTWQKSELNPILVGEPEDVEVTGFRDPF
LAEWPALDLIRGEKSLYGFLSGGVSGKGPTVFLYAIPPDNLTEWKYLGPLADLTAGFRAP
GSWTGNFGVNWECVNFLSLQMVPTSKIFFSWWSSWFSGSVEQTAAGPRLRHEFDGVLDHG
SLYAPNSYVHPETQKRITIGWVREDGLPMSRCKARGWTGFLSLPRELFLSTTHNVTRGLQ
SPIEDIRSFKILESGSGGKTVKTLGIKPMDDLRTLRPSRPAEWSSLGRTSAAGILRERTR
NQSWELDAVITVDPRQRRVGFNICQSPDGLQRTTVYFTPQTEQIVVDKSLSNTEADVDKS
LLDAPFTLLYSLENGTEKLEKLRLRIFRDGDVLEVFANDRFALTTTVYCDDSCAGISWFL
DDEGSHSVFDSVQLWEDMAGTQGQVPEIGQPHL
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttgtcacgacacgcaccaccgctcacgaggcgtccacacaggcacgtctgcct
ctgaagcaccatgcaccctcataccatttgaaggctcgcggctggatgaacgatccgtgc
ggcccaggttacaaccccatcacaaaaacctatcacatcttttatcaatggaatccgtat
ggctgtgagtggggcaacatgtcttggggtcatgcaacgagccaagatggtttgcgttgg
acacatgctccctcgggcgagcccgctctcaaacctagtgagccctatgacaaggagggc
atcttcactggctgcttctggcccaccggacctcacggcgagaaggaccagctcaccgtc
gtctactcgtccattgccgccctgcccatccactggacgttgaagcacatacgcaactcg
gagggcgtgtcgctcgctacttccacagatgctggcaagacgtggcagaagagcgagctc
aaccccatcctcgtgggcgagcccgaggacgtcgaagtcaccggctttcgcgacccgttc
ctcgccgagtggcctgcgctcgacctcattcgcggcgagaagagcctctacggcttcttg
tccggcggcgtctccggcaagggccccacggtgttcttgtacgccatccctcctgacaac
ctcacggagtggaaatatctcggtcccctcgctgacctgacggccgggttccgcgccccc
ggctcctggacgggcaatttcggcgtcaactgggaatgtgtcaactttctcagcctgcag
atggtgcccacgagcaagattttcttctcatggtggtcatcgtggttctccggttcggta
gagcagactgcggccggcccacgtctgcggcacgagtttgacggtgttctggatcacggc
agcctgtacgcgcccaactcctatgttcatcctgagacgcaaaagaggatcaccatcggc
tgggttcgagaggatggcctgccaatgagccgttgcaaagcaaggggctggacgggcttc
ttgtccttgccacgagaactgttcctctccacgacacacaatgtgaccaggggcctgcaa
tcgccaatcgaggacattcgttctttcaagattctggagagcggctcgggcggaaagacc
gtgaagacgttgggaatcaagcccatggacgacctccgaacactgcgcccctcccgtccg
gcagagtggtcatctctgggccggacgagcgctgccggcatcctgcgagagcggacccgc
aaccagagctgggagctcgacgccgtgatcacagtcgaccccaggcagaggcgcgtcggt
tttaacatatgccaaagccccgacggcctgcagaggacgactgtgtacttcaccccccag
actgagcagattgtcgttgacaagagtctctccaacaccgaggcggacgtcgacaagtcg
cttctcgatgcgccctttacacttctgtactcgcttgaaaacgggacggagaagctggag
aagcttcgcttgcgcatcttccgtgatggagatgtgctcgaggtctttgccaacgatcgc
tttgcattgaccacaacagtctactgcgacgattcgtgcgcgggcatcagctggttcctc
gatgacgaagggtcacacagcgtgtttgattcggtccagctgtgggaggacatggccggc
acgcagggacaggtgcccgaaatcggacagcctcatctgtaa

DBGET integrated database retrieval system