KEGG   Vulcanisaeta distributa: Vdis_0074Help
Entry
Vdis_0074         CDS       T01313                                 

Definition
aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
vdi  Vulcanisaeta distributa
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:vdi01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:vdi00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(72694..74550)
Genome map
AA seq 618 aa AA seqDB search
MTVFRILRVDLSREHFTEEIIKEDLLKKFLGGRGLAAYLALKEIPRGIDPFDPSNKLYIF
SGPLSGIATISSSRVNVTTRSPLTGVYTHSNAGGNFSYWLRKSGYDGLIIEGKADEPVYL
VIKDGEPKLKPAKHIWGKWTGASTKIILEENGFPPDETKAGVAVIGPAGENLVRFAGIRL
SDYERFAGRGGVGAVMGSKLLKGILVWGTRDLNKELVDRAKFMKVNTDIVKRIATHDTTK
VLHRYGTNVLMNIIQSIGALPHYNFGGTGKLKDVTPVSEEYIKDHYPTETHGCYNCPIGC
TQMPTVKSGPFKFTVTEKYVKQEYENTWALGPNVGLTDPEANLKLQKLANELGLDTISLG
NTLSMAIELVKNGKLNLDIDWGDAGSLEYLVYKIAYRDGIGDDLAEGDYRLAVKYGMPQL
FVGSRGQGLPAYDARALKGFAIAYYTANRGGDHLEAYTPTWEVFGVPEKVDPFCETQECI
EKQARIVKWNQDLFAVVDSTIFCKFENLMPNIDTEKDFANLYNAAFGWDLTPQDVLTIGE
RIFNVERLHWVREGKWVKDELPPRMREPIPDGPAKGHTASKMFDEGIKVYYKLRGWVDGK
PTRDTLKRLGLEEFDYLL
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgacagtttttagaatactaagagtcgatctatcgagagagcacttcaccgaggagata
ataaaggaggaccttctgaagaagttcctcggtggtaggggattagccgcgtatttggca
cttaaggagataccgaggggtatcgacccattcgaccctagcaataaactttacatattc
tcaggtccattaagtggcattgccacgatatcctcaagtagggttaatgtaacgactagg
tcaccattaacgggcgtatacacgcattcgaacgcaggtggtaacttctcatattggctc
aggaagtctggctatgacggattaataatcgagggtaaggccgacgagccggtatattta
gtgattaaagatggggagccgaaactaaaacctgccaagcacatctggggcaaatggact
ggggcatccactaagataatacttgaggagaatggattcccgccagacgagactaaggct
ggcgttgcggtaataggcccagctggtgagaacctcgttaggttcgcgggcattaggctt
agcgattatgagaggttcgcgggcaggggcggcgtcggtgctgtgatgggtagtaagttg
cttaagggtatattggtttggggtactagggacttaaataaggagctcgttgatagggct
aagttcatgaaggttaatacggatattgtcaagagaatagcgacccacgacacgacaaag
gttcttcataggtatggtacgaacgtactaatgaacataatacaatcaataggcgcactg
ccccactataacttcggcggtactgggaagcttaaggacgtgactccagtcagtgaggag
tacattaaggatcactacccaacggagacccacggatgctataactgcccaataggctgt
acgcaaatgcccacggtgaagtcaggcccatttaagttcaccgttaccgagaagtacgtg
aagcaggagtacgagaacacctgggcccttggaccaaacgtcggcttaacagacccagag
gctaacctcaagcttcagaagttggctaatgaactcggtctggacacaataagcttaggc
aatacattatcaatggcgattgaactcgttaagaatggcaagttgaacctagacattgac
tggggcgatgcgggctcccttgagtacctggtgtataagatcgcctatagggatggcatt
ggcgatgacttggccgagggtgactacaggctcgcggttaagtacggcatgccccagctg
ttcgttggatcgaggggccagggattacctgcatacgacgcgagggcactaaagggcttc
gcaatagcctactacacggctaataggggtggcgaccacctagaggcctacacaccgact
tgggaggtgttcggcgtacctgagaaggttgacccattctgcgaaacgcaggagtgcatc
gagaagcaggcaaggattgttaagtggaaccaggacctattcgccgtcgttgactcaacg
atattctgcaagttcgagaacctaatgcccaacatagacaccgagaaggacttcgcgaac
ctatacaacgctgccttcgggtgggacctaacaccgcaggacgtgctcacgattggcgag
aggatattcaatgtcgagagactccactgggtcagggaaggtaagtgggttaaggatgag
ttgccgcctaggatgagggagccaataccagacggcccggcaaagggacataccgcgtcc
aagatgtttgatgagggaataaaggtgtactataagttgaggggttgggtcgacggcaag
ccaacaagggacacactgaagagactggggcttgaggagttcgattacctattatag

DBGET integrated database retrieval system