KEGG   Vulcanisaeta distributa: Vdis_0105Help
Entry
Vdis_0105         CDS       T01313                                 

Definition
(GenBank) peptidase M20
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
vdi  Vulcanisaeta distributa
Pathway
vdi00300  Lysine biosynthesis
vdi01100  Metabolic pathways
vdi01120  Microbial metabolism in diverse environments
vdi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vdi00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Vdis_0105
Enzymes [BR:vdi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Vdis_0105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 Peptidase_M42 Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ADN49518
JGI: Vdis_0105
UniProt: E1QSC5
Position
complement(103871..105193)
Genome map
AA seq 440 aa AA seqDB search
MDLLKLLEVLVEFDTVNDPDNGRMPDPGVVDFVEGVLNGLGVKTRVLVSHGYRSVVGVIG
SGEPRVLLMAHLDVVPFVRSEWRYDPLRLTVEGDLAYGRGALDDKGNVAAVLKALEDLVS
IGKGTVIVAFTTDEEVGGENGARVVRDYLLGNGLRPNYVVNADGQLMVIINRRRAIFNAR
IRSRVERAVVNGRRETIRFQLDYKVTPPYHAAYFIGGVDTHPVIALSQYVWLNNAYVANL
RGGFVKSNVTPTWVEADVIKPCSDCPQQEVDVGLTRLVKALLPLTRFVPRIKAQSVYGIT
ATPNVYRVVGDYHEFVINVRAMTDDAKAIEEAMGDALREDFQGVEVRVEGEGGGGYLYTP
RDSRLVKLASEVLTELGLEARVVEMAGASDARYFSPLGIETIDFGPVGGNAHGPNEYVSI
KSLETTARFYSLLVRRLISS
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggacctacttaaactgctcgaggttctcgtagagttcgatacagtgaatgacccggac
aatggtaggatgcccgaccctggcgttgttgattttgtcgagggtgtgttgaatgggctt
ggcgtaaagaccagggttttggttagtcatgggtataggagtgtggttggtgtcattggt
tctggtgagccccgcgtactactcatggcacacctcgatgttgttccgtttgtacgcagt
gagtggaggtatgacccgcttaggttgacggttgagggtgaccttgcgtatggtcgtggc
gcgcttgatgataagggtaatgtggctgccgtgcttaaagccttggaggacttagtgagt
attggtaagggcacggtaattgttgcgttcactactgatgaggaggttggaggtgagaat
ggggctagggtagttagggattacctattgggtaatggccttaggccgaactatgtggtt
aatgctgatggtcagttaatggtcattataaataggaggagggcaatattcaatgctagg
atcaggtccagggttgagagggccgtggttaatgggcgtagggagaccattaggtttcaa
cttgattataaggtcacgcctccataccacgccgcgtacttcattggcggtgttgataca
cacccagtcattgccctctcacaatacgtatggctcaacaatgcttacgtggctaacctt
aggggtggctttgttaaaagtaatgttacgccgacctgggttgaggctgacgtgattaag
ccctgcagtgactgcccacagcaagaggttgatgtggggctaacgaggctagttaaggcc
ctactaccgttgactaggttcgtgcccaggattaaggcgcagagcgtttatggtatcaca
gccacgcccaacgtctatagggttgttggtgattaccatgagtttgtgattaatgttagg
gccatgactgacgatgcgaaggctattgaggaggcgatgggtgatgcgttgagggaggat
ttccagggggttgaggttagggttgagggtgagggcggtgggggatacctatacactcca
cgtgactcaaggctcgttaagctagccagtgaggtgcttactgagcttggtcttgaggct
agggtagtggagatggccggcgcgagtgatgccaggtacttctcaccgcttggtattgag
accatagacttcgggccagtgggtggtaatgcccatggaccgaatgagtacgtaagcata
aagtcccttgagaccacggctaggttttactcattattggttaggcgattaatttcttca
taa

DBGET integrated database retrieval system