KEGG   Vulcanisaeta distributa: Vdis_0224Help
Entry
Vdis_0224         CDS       T01313                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
vdi  Vulcanisaeta distributa
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vdi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Vdis_0224
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Vdis_0224
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Vdis_0224
Enzymes [BR:vdi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Vdis_0224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
224838..225557
Genome map
AA seq 239 aa AA seqDB search
MVIRKPGLGAYITATYPSKEAFLNAVKCLSNVSDFLEIGIPTQNPKYDGPVIRKTHFASE
LKGLDAVKVARYGDVPTILMGYIEDYVSNMELVAETANEVGASSVLFPDLLFEHIDLLES
YLGVMRDYSLRPTFFVSSNTPHRLIASLVKYEPLFIYLGLYAATGIKLPLYIERNVREVR
KLVDDVTLIAGFAINTPEMVRLVINAGADAVVVGTALVDKLNDQRACTEFMMKLRGGLP
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggtcataaggaaaccgggcctgggcgcgtacataacggccacatacccaagtaaagaa
gctttcctaaatgcagttaagtgtctatcgaatgtctcggacttccttgaaataggaata
ccaacacaaaacccgaagtatgacggccccgttataagaaagacgcacttcgcctctgag
ctcaagggcttagacgcggttaaggttgctaggtatggtgatgtgccaacgatactcatg
ggctatattgaggactatgtgagtaatatggagctcgttgccgaaacagccaatgaggtt
ggtgcatcctccgtactattcccagacctattattcgagcacatagaccttcttgagagc
tacttaggtgtaatgagggattactcattaaggcccacattcttcgtctcaagtaataca
ccgcataggttaattgcatcgctcgttaagtatgaaccactattcatatacctaggccta
tacgcagccactgggataaagttaccgctttatatcgagaggaatgttagggaggtcagg
aaactcgttgatgacgtgacgctcatcgcgggcttcgccataaacacgcccgagatggtt
aggctcgttattaacgccggcgccgacgccgtggttgttgggacggcgcttgtggataag
ttaaacgatcagagggcctgcacggaattcatgatgaagcttaggggtggtctgccatga

DBGET integrated database retrieval system