KEGG   Vulcanisaeta distributa: Vdis_0225Help
Entry
Vdis_0225         CDS       T01313                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vdi  Vulcanisaeta distributa
Pathway
vdi00260  Glycine, serine and threonine metabolism
vdi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vdi01100  Metabolic pathways
vdi01110  Biosynthesis of secondary metabolites
vdi01130  Biosynthesis of antibiotics
vdi01230  Biosynthesis of amino acids
Module
vdi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vdi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Vdis_0225
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Vdis_0225
Enzymes [BR:vdi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Vdis_0225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADN49637
JGI: Vdis_0225
UniProt: E1QT45
Position
225554..226795
Genome map
AA seq 413 aa AA seqDB search
MMIPHYWYNINVDLPKPLPPPIDPYEADSRIALLMRILPSELIDQEFTPLRYVPIPDEVR
ELYERMGRPTPFRRAYGLERALGNGVRIYYKFEGALPTGSHKLNTAIPQVYYALKDGARE
VVTETGAGQWGLAVSLAAALLGVKATVFMTRNSYFNKTQRVLFMRTYGAEVYPSPSELTK
YGREALRVRPDHPGSLGLAITEAIEFTLMGEGRKYIPGSVLGFVILHQTVIGQEVLQQMP
EEPDLVIGCVGGGSNFSGFSFPMIGAKLRGEGFEKTRFLAVESKAAPKLTSGRYMYDFPD
TGGLLPMVKMLTLGHDYVPPPTHAAGLRYHGAAPALSLLVREGIVEARAYGQEEVMEAAR
LFARTEGIIPAPESAHAIRAVIDEAKRMPKGSVIFFNLSGHGLLDVDAYSNVR
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgatgataccgcactattggtataacataaacgtggacctgccaaagccattaccacca
cccattgatccctatgaggccgattcaaggattgccctgctcatgaggatattacccagt
gagttaattgaccaggaattcacaccgcttaggtacgtgccaatacccgacgaggtcagg
gagctctacgaaagaatgggtaggccaacgccgtttaggagggcctatgggcttgagagg
gcgttgggtaatggcgttaggatttactataaattcgaaggcgcactaccgacgggctcc
cataagcttaacacggccataccccaggtatattacgcacttaaggatggggctagggag
gttgttacggagactggcgcggggcagtggggcctggcagtgtcgttggctgcggcgttg
ctgggtgttaaggccacggtatttatgacgaggaactcctacttcaataagacccagagg
gttctcttcatgaggacctacggcgcggaggtttacccaagccccagtgagttgacgaag
tatggtagggaggcattaagggttaggcctgatcacccaggcagcctgggcctggccatc
actgaggctattgaattcacgttaatgggtgagggtaggaagtacataccgggtagcgtg
ttgggcttcgtaatacttcatcaaacggtgattggacaggaggtgctacagcagatgccc
gaggagccggacctggtaattgggtgtgttggtggtggtagtaactttagtggtttctca
ttcccaatgatcggggctaagcttaggggtgaggggtttgagaagactaggttcctagcc
gtggagtcaaaggcagcgcctaaactaaccagtggtaggtacatgtatgacttccccgac
acaggcgggctactgccgatggttaagatgctcaccctaggccacgactacgtaccaccg
ccaacacatgcagcagggctcaggtaccacggggcagcgccggcactatcgttattagtt
agggagggcattgttgaggccagggcttatgggcaggaggaggtcatggaggcggctagg
ctatttgccaggactgaaggtataataccagctccagagtctgcccatgcaataagggct
gtgattgacgaggctaagaggatgcccaagggctcagtcatattctttaatctatcggga
cacggcctcctcgacgttgatgcatatagtaatgtgaggtga

DBGET integrated database retrieval system