KEGG   Vulcanisaeta distributa: Vdis_0225Help
Entry
Vdis_0225         CDS       T01313                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vdi  Vulcanisaeta distributa
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vdi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Vdis_0225
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Vdis_0225
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Vdis_0225
Enzymes [BR:vdi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Vdis_0225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
225554..226795
Genome map
AA seq 413 aa AA seqDB search
MMIPHYWYNINVDLPKPLPPPIDPYEADSRIALLMRILPSELIDQEFTPLRYVPIPDEVR
ELYERMGRPTPFRRAYGLERALGNGVRIYYKFEGALPTGSHKLNTAIPQVYYALKDGARE
VVTETGAGQWGLAVSLAAALLGVKATVFMTRNSYFNKTQRVLFMRTYGAEVYPSPSELTK
YGREALRVRPDHPGSLGLAITEAIEFTLMGEGRKYIPGSVLGFVILHQTVIGQEVLQQMP
EEPDLVIGCVGGGSNFSGFSFPMIGAKLRGEGFEKTRFLAVESKAAPKLTSGRYMYDFPD
TGGLLPMVKMLTLGHDYVPPPTHAAGLRYHGAAPALSLLVREGIVEARAYGQEEVMEAAR
LFARTEGIIPAPESAHAIRAVIDEAKRMPKGSVIFFNLSGHGLLDVDAYSNVR
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgatgataccgcactattggtataacataaacgtggacctgccaaagccattaccacca
cccattgatccctatgaggccgattcaaggattgccctgctcatgaggatattacccagt
gagttaattgaccaggaattcacaccgcttaggtacgtgccaatacccgacgaggtcagg
gagctctacgaaagaatgggtaggccaacgccgtttaggagggcctatgggcttgagagg
gcgttgggtaatggcgttaggatttactataaattcgaaggcgcactaccgacgggctcc
cataagcttaacacggccataccccaggtatattacgcacttaaggatggggctagggag
gttgttacggagactggcgcggggcagtggggcctggcagtgtcgttggctgcggcgttg
ctgggtgttaaggccacggtatttatgacgaggaactcctacttcaataagacccagagg
gttctcttcatgaggacctacggcgcggaggtttacccaagccccagtgagttgacgaag
tatggtagggaggcattaagggttaggcctgatcacccaggcagcctgggcctggccatc
actgaggctattgaattcacgttaatgggtgagggtaggaagtacataccgggtagcgtg
ttgggcttcgtaatacttcatcaaacggtgattggacaggaggtgctacagcagatgccc
gaggagccggacctggtaattgggtgtgttggtggtggtagtaactttagtggtttctca
ttcccaatgatcggggctaagcttaggggtgaggggtttgagaagactaggttcctagcc
gtggagtcaaaggcagcgcctaaactaaccagtggtaggtacatgtatgacttccccgac
acaggcgggctactgccgatggttaagatgctcaccctaggccacgactacgtaccaccg
ccaacacatgcagcagggctcaggtaccacggggcagcgccggcactatcgttattagtt
agggagggcattgttgaggccagggcttatgggcaggaggaggtcatggaggcggctagg
ctatttgccaggactgaaggtataataccagctccagagtctgcccatgcaataagggct
gtgattgacgaggctaagaggatgcccaagggctcagtcatattctttaatctatcggga
cacggcctcctcgacgttgatgcatatagtaatgtgaggtga

DBGET integrated database retrieval system