KEGG   Vulcanisaeta distributa: Vdis_0272Help
Entry
Vdis_0272         CDS       T01313                                 

Definition
carbohydrate kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
vdi  Vulcanisaeta distributa
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vdi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Vdis_0272
Enzymes [BR:vdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Vdis_0272
Exosome [BR:vdi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Vdis_0272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
272582..273988
Genome map
AA seq 468 aa AA seqDB search
MSLGVIDVGTTNIKLIIYDEELNQRYSETVNVPMAFPGNYRVEQDANALRSAFNHLVSTA
RDRGVKYLGISTYRASVLAWDRSGNPLINIITWLDRRGLEIVNKFPYSIMRHLPLLSSIL
IPTSPVVQILWLLRNRRGLIERVRRGEVFIGTLSSYLAYIIGNRYVNDASNEALTGLWHP
GNFRRIDAVYELLGIPREVGPDVVDNIHEFGEVNGMRVGVLIADQQAAMVGEGCLSIGCG
KVTNGTGSFVDAVTDKFRLAGGGLLPLLILKYGNTVYYGIEGFLPATGSVIDWLIKLGLL
SSPQELDGLVNVDTQGIVVVPALAGVNVPPRPCARGLIDGLTLNTTRESFVRAVIEGIVQ
LIGLIFDKIRNYSRVNVVRVDGGLSRSVLFLKLLATALDTAVERQRDVEATARGVAALLK
VFRGDWSLNDIIKGAHVNVELRIKPGEEKLSLSRDVVRRIVEGMRCRM
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttggggtaattgatgttggtactacgaatattaagctcataatatatgacgaa
gagcttaaccagagatattcagaaaccgtaaatgtaccgatggcattccccggcaattac
cgcgttgagcaggatgcaaacgcacttaggtctgccttcaatcacttagttagcacggct
agggacaggggcgttaagtacctaggcatctcaacctatagggcatcagtacttgcgtgg
gataggtctggtaatccactaataaacataatcacgtggttggataggaggggtctggaa
atcgttaataagttcccatactcaatcatgagacatttaccattactgagcagcatctta
ataccgacatcaccagtagtacaaatactctggctattaaggaataggcggggcttaatt
gaacgtgtaaggaggggggaggtcttcattggtacgttaagttcgtacttagcatacata
attggtaataggtatgttaatgatgccagtaatgaggcgttaactggactgtggcatcca
ggtaattttaggaggattgatgcggtatatgaattattgggaatacctagggaggtgggg
cctgatgttgttgataacattcatgagttcggtgaggttaatggaatgagggttggggtc
ttaatagctgatcaacaggcagcgatggttggtgagggctgcctaagcattggttgtggt
aaggtcactaacggtactggctccttcgtggatgcagtcactgataagtttaggctcgct
ggcggtggtttactaccactcctcatacttaagtacggtaacacggtgtattacggaatt
gagggcttcctgccggcgactggttcagtaattgattggttaattaagcttgggttacta
tcttcaccgcaggagttagatggtttagtcaatgttgatactcagggcatagtggttgta
ccggcgttggcaggtgttaatgtaccaccaaggccatgcgccaggggcttaattgatggc
ctgacacttaataccacgagggagtccttcgtgagagcagttattgagggtatcgttcaa
ttaataggccttattttcgacaaaattaggaattactcaagggttaatgtcgttagggtt
gacggtggtttatcaaggagcgtattattccttaagttattggctacggcattggatacc
gccgttgagaggcagagggatgtggaggcaacggctaggggtgttgcggcattattgaag
gtttttaggggtgattggtcattaaacgacattattaagggggcccacgttaatgtggag
ttacgtattaagcctggtgaggagaaactatcattaagtagggatgttgttaggaggatt
gttgaggggatgagatgcagaatgtga

DBGET integrated database retrieval system